(data stored in ACNUC9435 zone)

EMBL: CP000904.PE272

CP000904.PE272       Location/Qualifiers
FT   CDS             383713..385068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5746"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5746"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46696"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX5"
FT                   /protein_id="ABY46696.1"
FT                   /translation="MDELLGKKVELDTELERSIIEYRPRVKYEPNKPFTVNLPTEEIIG
FT                   EDQKEFDEDGSFIPEEKPAKQYDKFVGTLELINELIEYIEKKMKGLQVPISIEELEKLY
FT                   ESQPFFEQDIGDEGFIDFETYQKTFENPEAPANSLIQDIVHSYAEDVEGSLELEFYEDL
FT                   KELHSIVEEGYFLFKETVLKNYLDGNIPKTPENNNGFTEQIEKAVKKQKQWFDQVTNLY
FT                   RNNESKYYDALRTQYGSPEFFKISDEYTKTKRPYDVVVRKEKTLNEVSSLIDGLLIGSQ
FT                   DCSESIKFGLAIGSEIDGEGVMNLLENQASTKEQLTGLLKLTQLSLKLQLNQQIEDKKQ
FT                   YRDVLKNINNLSRKKRAHDELLMALELRNTMYLNMYDSLQHLESPSKAPGVESFLNQMA
FT                   GGLSLVQEQYDSFLQDVYAMYMSEYEVRKEKIDKTLNKENARAGYSLVSEYL"
     MDELLGKKVE LDTELERSII EYRPRVKYEP NKPFTVNLPT EEIIGEDQKE FDEDGSFIPE        60
     EKPAKQYDKF VGTLELINEL IEYIEKKMKG LQVPISIEEL EKLYESQPFF EQDIGDEGFI       120
     DFETYQKTFE NPEAPANSLI QDIVHSYAED VEGSLELEFY EDLKELHSIV EEGYFLFKET       180
     VLKNYLDGNI PKTPENNNGF TEQIEKAVKK QKQWFDQVTN LYRNNESKYY DALRTQYGSP       240
     EFFKISDEYT KTKRPYDVVV RKEKTLNEVS SLIDGLLIGS QDCSESIKFG LAIGSEIDGE       300
     GVMNLLENQA STKEQLTGLL KLTQLSLKLQ LNQQIEDKKQ YRDVLKNINN LSRKKRAHDE       360
     LLMALELRNT MYLNMYDSLQ HLESPSKAPG VESFLNQMAG GLSLVQEQYD SFLQDVYAMY       420
     MSEYEVRKEK IDKTLNKENA RAGYSLVSEY L                                      451
//

If you have problems or comments...

PBIL Back to PBIL home page