(data stored in ACNUC9435 zone)

EMBL: CP000904.PE273

CP000904.PE273       Location/Qualifiers
FT   CDS             385541..387040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5747"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46697"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX6"
FT                   /protein_id="ABY46697.1"
FT                   /translation="MYTYNQLIFPSHMEKNTRFLVLAGFSLNGPVGTPFIIRDNIEPSY
FT                   ILGDCRLTENVSMAKKYGITPLILRLNGSHGECVVNHDELNTPAFRFKTLEATDESNNI
FT                   AIHLFPTYMIIKGINTSYSYLFADYKGVDDLAFAIKQDLYFGSGEVDVEVINQIPIKGL
FT                   CTSEKHVRFTGADDGFHYVSNHSNPDSEDKIQMQLQLLKDSFITEDGSEVFFTGELSSF
FT                   QVDTLLFTDIPYEKAPGQLSSIFGEFAKTKTTEQSIFCSVVLCSDLFSKSRYTVTGEDT
FT                   YETQVQLLVEKASINTEEHRHLEHIEVVVGIQNSENPKYSFMPVAANYACMRYKLPNFH
FT                   NSATNKQLLNINTLQNRELKKVEVAKLTSSGYICIVPSIKKGFVPYSSRNLYLQNKFYS
FT                   KPHYLRSIGYDVNRIAGFFNQYIGEPLSFVLLQSIITQVDAFIDSLAEDHPIYRDIKME
FT                   VLHYDQENLTLSISFELYGEIETVRTSFTYISSSEVSVSWQ"
     MYTYNQLIFP SHMEKNTRFL VLAGFSLNGP VGTPFIIRDN IEPSYILGDC RLTENVSMAK        60
     KYGITPLILR LNGSHGECVV NHDELNTPAF RFKTLEATDE SNNIAIHLFP TYMIIKGINT       120
     SYSYLFADYK GVDDLAFAIK QDLYFGSGEV DVEVINQIPI KGLCTSEKHV RFTGADDGFH       180
     YVSNHSNPDS EDKIQMQLQL LKDSFITEDG SEVFFTGELS SFQVDTLLFT DIPYEKAPGQ       240
     LSSIFGEFAK TKTTEQSIFC SVVLCSDLFS KSRYTVTGED TYETQVQLLV EKASINTEEH       300
     RHLEHIEVVV GIQNSENPKY SFMPVAANYA CMRYKLPNFH NSATNKQLLN INTLQNRELK       360
     KVEVAKLTSS GYICIVPSIK KGFVPYSSRN LYLQNKFYSK PHYLRSIGYD VNRIAGFFNQ       420
     YIGEPLSFVL LQSIITQVDA FIDSLAEDHP IYRDIKMEVL HYDQENLTLS ISFELYGEIE       480
     TVRTSFTYIS SSEVSVSWQ                                                    499
//

If you have problems or comments...

PBIL Back to PBIL home page