(data stored in ACNUC9435 zone)

EMBL: CP000904.PE274

CP000904.PE274       Location/Qualifiers
FT   CDS             387031..387669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5748"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46698"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX7"
FT                   /protein_id="ABY46698.1"
FT                   /translation="MAVEINKPTQANGSMDYEDMTKTIKHLLDAAWGTQWGSFTPEEPT
FT                   VTVDKPVEYPVIIHYLKLMQPGLIGKSIREIKPRQRYLAFNEDPKGTLPPATKVYGQVF
FT                   DAEIVFEIWEETNARVDKLTKEFRQTLATFTGFLKEKGLKELQFVKMETDLSKTNISNA
FT                   SKVRRLVYFAKFEELTEVPVDILRVIDVVEQKLQETTKTLRNKKIQLDE"
     MAVEINKPTQ ANGSMDYEDM TKTIKHLLDA AWGTQWGSFT PEEPTVTVDK PVEYPVIIHY        60
     LKLMQPGLIG KSIREIKPRQ RYLAFNEDPK GTLPPATKVY GQVFDAEIVF EIWEETNARV       120
     DKLTKEFRQT LATFTGFLKE KGLKELQFVK METDLSKTNI SNASKVRRLV YFAKFEELTE       180
     VPVDILRVID VVEQKLQETT KTLRNKKIQL DE                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page