(data stored in ACNUC9435 zone)

EMBL: CP000904.PE275

CP000904.PE275       Location/Qualifiers
FT   CDS             387716..389431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5749"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5749"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46699"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX8"
FT                   /protein_id="ABY46699.1"
FT                   /translation="MLYENLPGINVTLKDGGLIVPERGGSESILIIAPSLAKDAPEEPV
FT                   LIRSSTELVQAGFGDFYVAGEVNPIAAEWKAATDAGARMVYLVALKEISLERAAELEKN
FT                   AIDAYVAAGNQLVDAQAKFKDVLVGSTEAVRMRRKFIYFYDMLMSDLLDFTVDHVVLKG
FT                   VTLEDEATNLVGEFFTEVPNSEDFPYISGMVTSSYVIESHSINYPVEIKTGTSDTLVVK
FT                   VDGKDVTFTLPAKTYNGSSLTIADLVKDLKAVIDADATGIKVNVREDSGKIVLYFDAPA
FT                   SIQAGTTAAGLQLDKQVATWKKTSFGVIHRGSFAQTVADYCSMKTLMKSAAIGYIGVKS
FT                   PVDTKVSTIRKYVDELSKIDTEISPYLQVVGSEVGVIMPTTNSIHYVNGATHYAALLST
FT                   LRKESAPTNKPIKGVKAIRFDYSLRQLSKLTSKKIVTFRLKDSTQLVVTDGITTAPSIV
FT                   MAGKVRESDFARLSTLRITQLAIQVVREAVEPFIGEANEMPQYNAMNTAIKSALEKIRE
FT                   AGAIQGYKFSIENLGVYLDEVTVTLEIIPAFELRRVQVQVNLTPPEYMLQGLSK"
     MLYENLPGIN VTLKDGGLIV PERGGSESIL IIAPSLAKDA PEEPVLIRSS TELVQAGFGD        60
     FYVAGEVNPI AAEWKAATDA GARMVYLVAL KEISLERAAE LEKNAIDAYV AAGNQLVDAQ       120
     AKFKDVLVGS TEAVRMRRKF IYFYDMLMSD LLDFTVDHVV LKGVTLEDEA TNLVGEFFTE       180
     VPNSEDFPYI SGMVTSSYVI ESHSINYPVE IKTGTSDTLV VKVDGKDVTF TLPAKTYNGS       240
     SLTIADLVKD LKAVIDADAT GIKVNVREDS GKIVLYFDAP ASIQAGTTAA GLQLDKQVAT       300
     WKKTSFGVIH RGSFAQTVAD YCSMKTLMKS AAIGYIGVKS PVDTKVSTIR KYVDELSKID       360
     TEISPYLQVV GSEVGVIMPT TNSIHYVNGA THYAALLSTL RKESAPTNKP IKGVKAIRFD       420
     YSLRQLSKLT SKKIVTFRLK DSTQLVVTDG ITTAPSIVMA GKVRESDFAR LSTLRITQLA       480
     IQVVREAVEP FIGEANEMPQ YNAMNTAIKS ALEKIREAGA IQGYKFSIEN LGVYLDEVTV       540
     TLEIIPAFEL RRVQVQVNLT PPEYMLQGLS K                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page