(data stored in ACNUC9435 zone)

EMBL: CP000904.PE276

CP000904.PE276       Location/Qualifiers
FT   CDS             389502..389684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5750"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46700"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUX9"
FT                   /protein_id="ABY46700.1"
FT                   /translation="MSTTASRYSKTFTTYGGSDIVCTFNGQVVGQLQAITYSVTREKGP
FT                   VYVMGDPNPKSFSRG"
     MSTTASRYSK TFTTYGGSDI VCTFNGQVVG QLQAITYSVT REKGPVYVMG DPNPKSFSRG        60
//

If you have problems or comments...

PBIL Back to PBIL home page