(data stored in ACNUC9435 zone)

EMBL: CP000904.PE277

CP000904.PE277       Location/Qualifiers
FT   CDS             390836..391333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5752"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46701"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY0"
FT                   /protein_id="ABY46701.1"
FT                   /translation="MSSRYQKTYTSFAGTDIVAVVTPEGGKSVVLGQLQTISYSVYRPT
FT                   APVFALGQIAAKGVVRGARTVAGSLIFTVFDRHVLYEIMKDHNANGNSCPINKSDELPP
FT                   FDITINFMNEYGQSSKLAIYGINLISEGQTMSVEDMITENTMEFIALDIETMKPDVFDE
FT                   GW"
     MSSRYQKTYT SFAGTDIVAV VTPEGGKSVV LGQLQTISYS VYRPTAPVFA LGQIAAKGVV        60
     RGARTVAGSL IFTVFDRHVL YEIMKDHNAN GNSCPINKSD ELPPFDITIN FMNEYGQSSK       120
     LAIYGINLIS EGQTMSVEDM ITENTMEFIA LDIETMKPDV FDEGW                       165
//

If you have problems or comments...

PBIL Back to PBIL home page