(data stored in ACNUC9435 zone)

EMBL: CP000904.PE278

CP000904.PE278       Location/Qualifiers
FT   CDS             391339..392055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5753"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5753"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY1"
FT                   /protein_id="ABY46702.1"
FT                   /translation="MSDGAYTPAGKPKRGYANYYSGTDIRIYFGDNWIDEIVEIEWTMQ
FT                   EQLAPIYGYASYTWDKVARGNRLVQGSFSINFKEAGYLQTVLNSLSSEMKDENEWFSLA
FT                   EFNGENGQSAHKNTKVEDLIGNFQALADDYENALWGTNSNSSKLIDSRKTDTFFYSTNE
FT                   NEKNKNLKEHGFNILLTYGNNPCAVRGAGSYKTVQTIVGVQLTGVSQRVDPSGNPISEV
FT                   YTFIAKDISGNVQKAY"
     MSDGAYTPAG KPKRGYANYY SGTDIRIYFG DNWIDEIVEI EWTMQEQLAP IYGYASYTWD        60
     KVARGNRLVQ GSFSINFKEA GYLQTVLNSL SSEMKDENEW FSLAEFNGEN GQSAHKNTKV       120
     EDLIGNFQAL ADDYENALWG TNSNSSKLID SRKTDTFFYS TNENEKNKNL KEHGFNILLT       180
     YGNNPCAVRG AGSYKTVQTI VGVQLTGVSQ RVDPSGNPIS EVYTFIAKDI SGNVQKAY         238
//

If you have problems or comments...

PBIL Back to PBIL home page