(data stored in ACNUC9435 zone)

EMBL: CP000904.PE279

CP000904.PE279       Location/Qualifiers
FT   CDS             392135..392578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5754"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5754"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46703"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY2"
FT                   /protein_id="ABY46703.1"
FT                   /translation="MAKRFEKEEAFTENAQEETSVVKVGDKFDEDDVSKAEQEIFPGGP
FT                   TYNELEKWKSMYAGEVYLTEFDEENIFVWRPIKRKEYKDIAKIPNADNFYKEERICEKA
FT                   VLFPANYGFMQMTNGKAGIPTLLHELVLEKSGFAAKTGAMRLS"
     MAKRFEKEEA FTENAQEETS VVKVGDKFDE DDVSKAEQEI FPGGPTYNEL EKWKSMYAGE        60
     VYLTEFDEEN IFVWRPIKRK EYKDIAKIPN ADNFYKEERI CEKAVLFPAN YGFMQMTNGK       120
     AGIPTLLHEL VLEKSGFAAK TGAMRLS                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page