(data stored in ACNUC9435 zone)

EMBL: CP000904.PE28

CP000904.PE28        Location/Qualifiers
FT   CDS             complement(50849..51721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5461"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: lwe:lwe1801 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5461"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46452"
FT                   /db_xref="GOA:A9VV20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV20"
FT                   /protein_id="ABY46452.1"
FT                   /translation="MEIKELNTFKMIVEEGTFSLAAKKLNYAQSTVTTHIKKLENELGF
FT                   LLFERGWDARLTEEGTLFAKEVDNLLMHWDYSVSQAQRISNEEKGRVRIGLTESVAKKL
FT                   MPSILNYLDNEKPYIHCDFVVGNTALLSQLLEQNKIDFAVCGNNKNSSNMNFTPLYNEQ
FT                   IEFIVNNPHHPILHKESIEVFDIVNYPILIGENSCYYYQSVNAFLSENNLSFKRIYNCS
FT                   ALHLIPQMVFGNAIGIIPKGTILNKGNISFKVKGFDPQMPIGLLISSKNRNYLSQTKQR
FT                   LMKLIESLL"
     MEIKELNTFK MIVEEGTFSL AAKKLNYAQS TVTTHIKKLE NELGFLLFER GWDARLTEEG        60
     TLFAKEVDNL LMHWDYSVSQ AQRISNEEKG RVRIGLTESV AKKLMPSILN YLDNEKPYIH       120
     CDFVVGNTAL LSQLLEQNKI DFAVCGNNKN SSNMNFTPLY NEQIEFIVNN PHHPILHKES       180
     IEVFDIVNYP ILIGENSCYY YQSVNAFLSE NNLSFKRIYN CSALHLIPQM VFGNAIGIIP       240
     KGTILNKGNI SFKVKGFDPQ MPIGLLISSK NRNYLSQTKQ RLMKLIESLL                  290
//

If you have problems or comments...

PBIL Back to PBIL home page