(data stored in ACNUC9435 zone)

EMBL: CP000904.PE280

CP000904.PE280       Location/Qualifiers
FT   CDS             392632..393201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5755"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5755"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46704"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY3"
FT                   /protein_id="ABY46704.1"
FT                   /translation="MLIDPNLLDDKVKELPIEFETYEEEVDFKEQLRIWHEKHGHIFMQ
FT                   EISDVLFFFRALSKEELKIAQEVYNDDYERTEYICKTCVIEPIIEDYSLDIFAGVPEIL
FT                   CLSILEESGYTKAQKVKIMIARWEKYMEETENQLPLIIKEAFQDIPLSEIESWTMAKTA
FT                   EYYVKAKWLLENIRGLKLLSEEEVQQ"
     MLIDPNLLDD KVKELPIEFE TYEEEVDFKE QLRIWHEKHG HIFMQEISDV LFFFRALSKE        60
     ELKIAQEVYN DDYERTEYIC KTCVIEPIIE DYSLDIFAGV PEILCLSILE ESGYTKAQKV       120
     KIMIARWEKY MEETENQLPL IIKEAFQDIP LSEIESWTMA KTAEYYVKAK WLLENIRGLK       180
     LLSEEEVQQ                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page