(data stored in ACNUC9435 zone)

EMBL: CP000904.PE281

CP000904.PE281       Location/Qualifiers
FT   CDS             393225..397577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5756"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5756"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46705"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY4"
FT                   /protein_id="ABY46705.1"
FT                   /translation="MADKRYMGEEKEKNHLLSNIAKTGSLKGGGVMAYRNFSMIGKSDA
FT                   LGETAYVSRKLRGGFDGNIQEKMYKKLENYVRRNIKKKQMLKNHLAQNNIEFVNRYYKE
FT                   FHKRNMWGFNKFEYAATQSFRQNKILENLLKLSSIKNNGGDKILNALIQYHNQNKGIFN
FT                   SPADYINDFIKQLENGKYAPKVKFLDDTQRNVFQKQMLQTLEWYQDIKKVFEENKGTIL
FT                   SQAKAMETASTYEFIQDAINQTDVLMTRLKKTGFNYTTLKDAEKLDTATKRKYGLIIDD
FT                   IDEKGNEKSIDVTGELRKFLDNNKHNDDLNALLGKKGISFVFENMILDSNLYTHAKTGE
FT                   IIDNRHLKAGAVRAIDSFQKSIKVPFFINSPMDLKSWQAFYSSLSKEELQVVASEQFHR
FT                   FVSNLDEKGFDSVTKTNQGGYIRNPLNNSDHFYTGGNVFPYTESGVRDLINEGSYLASS
FT                   QFGTFSRMDKSYARSGYKKELTGRDASQLYEDTSVKELGKGTWKYINLSEGFISLREAA
FT                   VDKSLPTLMEFMIPTFGEDVVRIPAIEKLRRSFHQFALRVLDNEASFFTQDVVKKDARN
FT                   KRILSELDIKNMKGLDTLTEFQGYDNIHTIDARPREAKILLEDVMNNDKGKAEKEIVSD
FT                   FNINNLKNYGAIDNGWDLAINTKMNASNAASTLVEQELAVSKDRLVGRHTYRDALANVK
FT                   NSTQDIEDIGRIDELSDFLKEEFYTASKLGNIYGFLTKTGVEYEDSWRGKTLVSSILRT
FT                   YPRHDFLVANHGSALPGIGRRYVSRGLNKVYYSPIRNKMSDCLTSIIGESTDLLLSDQI
FT                   QKNEIKLLGKVYETLVKHYSDGIGSDEFVNDGMFNRFPILAETNPNSGQYKVAKHQIPL
FT                   LRQSGGFTENMDKEFDEITKLIHDNQDTYYWYDKKFSNADIQEKSGTGSKIIDANTFMV
FT                   REFDTPVKLTQKDNRDVIYWMEQYFKLGEKDKIGFTRDLVARKNNNTYGSMDAVVYTNR
FT                   SEDGHFGFKTNKGQSFNALIGNRIWKNPFQISDDGSSTSTKAFNLNNMVAVGKYSEMLT
FT                   HDIVPKMPFAGILDDKFLQERTTIESYKRDQVYDSDWGPWPQPYEGWINTMINTVVSQN
FT                   PIITGEEMKAIGAGRILSRLGNVAVPQVREGEREINQHFDRLSYVKYYDLYEKSSKLAQ
FT                   SKEGESVEEFFDDAAGRGRNNIGLKRYLTDKKKTLSWAKKMGYGDTEAVKSKIDEFSDG
FT                   LGDISSTKEANQASKYIPLAIKYRQKYEGTLYSMGDTEDSGSTSLMRALKPKGKKYVPQ
FT                   FFETTSSKEGQEILQYVSEDTKEISQDSWGLRVDKQEDIEDYFNTHYLPTENWNGWNAS
FT                   TNLDDIKIKVMQKKGVNPTTSGYWSKDQARVEKTGEKEIQIHPLSSLINIGRLRDVLLG
FT                   MGLSDVDVQLTTSYGEGPGGINTSIDIMKNVKNEILDGFNAGVHSSLF"
     MADKRYMGEE KEKNHLLSNI AKTGSLKGGG VMAYRNFSMI GKSDALGETA YVSRKLRGGF        60
     DGNIQEKMYK KLENYVRRNI KKKQMLKNHL AQNNIEFVNR YYKEFHKRNM WGFNKFEYAA       120
     TQSFRQNKIL ENLLKLSSIK NNGGDKILNA LIQYHNQNKG IFNSPADYIN DFIKQLENGK       180
     YAPKVKFLDD TQRNVFQKQM LQTLEWYQDI KKVFEENKGT ILSQAKAMET ASTYEFIQDA       240
     INQTDVLMTR LKKTGFNYTT LKDAEKLDTA TKRKYGLIID DIDEKGNEKS IDVTGELRKF       300
     LDNNKHNDDL NALLGKKGIS FVFENMILDS NLYTHAKTGE IIDNRHLKAG AVRAIDSFQK       360
     SIKVPFFINS PMDLKSWQAF YSSLSKEELQ VVASEQFHRF VSNLDEKGFD SVTKTNQGGY       420
     IRNPLNNSDH FYTGGNVFPY TESGVRDLIN EGSYLASSQF GTFSRMDKSY ARSGYKKELT       480
     GRDASQLYED TSVKELGKGT WKYINLSEGF ISLREAAVDK SLPTLMEFMI PTFGEDVVRI       540
     PAIEKLRRSF HQFALRVLDN EASFFTQDVV KKDARNKRIL SELDIKNMKG LDTLTEFQGY       600
     DNIHTIDARP REAKILLEDV MNNDKGKAEK EIVSDFNINN LKNYGAIDNG WDLAINTKMN       660
     ASNAASTLVE QELAVSKDRL VGRHTYRDAL ANVKNSTQDI EDIGRIDELS DFLKEEFYTA       720
     SKLGNIYGFL TKTGVEYEDS WRGKTLVSSI LRTYPRHDFL VANHGSALPG IGRRYVSRGL       780
     NKVYYSPIRN KMSDCLTSII GESTDLLLSD QIQKNEIKLL GKVYETLVKH YSDGIGSDEF       840
     VNDGMFNRFP ILAETNPNSG QYKVAKHQIP LLRQSGGFTE NMDKEFDEIT KLIHDNQDTY       900
     YWYDKKFSNA DIQEKSGTGS KIIDANTFMV REFDTPVKLT QKDNRDVIYW MEQYFKLGEK       960
     DKIGFTRDLV ARKNNNTYGS MDAVVYTNRS EDGHFGFKTN KGQSFNALIG NRIWKNPFQI      1020
     SDDGSSTSTK AFNLNNMVAV GKYSEMLTHD IVPKMPFAGI LDDKFLQERT TIESYKRDQV      1080
     YDSDWGPWPQ PYEGWINTMI NTVVSQNPII TGEEMKAIGA GRILSRLGNV AVPQVREGER      1140
     EINQHFDRLS YVKYYDLYEK SSKLAQSKEG ESVEEFFDDA AGRGRNNIGL KRYLTDKKKT      1200
     LSWAKKMGYG DTEAVKSKID EFSDGLGDIS STKEANQASK YIPLAIKYRQ KYEGTLYSMG      1260
     DTEDSGSTSL MRALKPKGKK YVPQFFETTS SKEGQEILQY VSEDTKEISQ DSWGLRVDKQ      1320
     EDIEDYFNTH YLPTENWNGW NASTNLDDIK IKVMQKKGVN PTTSGYWSKD QARVEKTGEK      1380
     EIQIHPLSSL INIGRLRDVL LGMGLSDVDV QLTTSYGEGP GGINTSIDIM KNVKNEILDG      1440
     FNAGVHSSLF                                                             1450
//

If you have problems or comments...

PBIL Back to PBIL home page