(data stored in ACNUC9435 zone)

EMBL: CP000904.PE282

CP000904.PE282       Location/Qualifiers
FT   CDS             397638..403889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5757"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46706"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY5"
FT                   /protein_id="ABY46706.1"
FT                   /translation="MEDIKRVPIKNRVLRPINESADDLGEIRTENQTEHAAAEYRQSVL
FT                   AQTYNELTKDNRISTLGIWELARTPNNFNVNAQQALDPFMKLKGDDHVLFFDIEAIGTP
FT                   EHMRSNKGLDLFAMTELSFSGTNFNGKDFVNKKGAIVSMAVAPEKDVYARLKQQINKLK
FT                   QNPMMSVSQDVHCTLLDLTKYTDASKFKSATSNGKSYMSLLGHSRVPSIDTAFTRNTIE
FT                   EIERGLNNLFYKGTKLEDALSIFQGHIMSSNAKLGGYNIHHYDLPAILGIVKDTSTKKF
FT                   FNDAAKNSLDFFHGYSATVKNPYSLTGASLRQEHIYQALLAKRKIKAGKEAIDGNPPLF
FT                   LYHLAKDDIQANIDIAGFTHQKIKSFIKGAEESPTYDFSSSAIKKNTLELGQELFSYQS
FT                   SYFDKDKYKYNLVGKLGKDGKSIVPRWGNLNTSLPSNENFVIREFLKDVALTGTDKKGF
FT                   GLRLDSKDVKGKILLLMSETQEGLAQQIHSSFMPMDDAISRNLRDLKVKHDASFREYER
FT                   MFDNNGWEKMKEYYNYLEKAGSVEEDFDWRSYIIKNGGTEELAMKFPYMVARLEGERDV
FT                   WGTAISTLKASGLSDKQKSIALRQIKSKLDEKGDNKAQVTAKGNRFLNFNFDKEYNTIF
FT                   NAKETNSIKDSFRSYINDRRGDRIGNLEKSYKLARIDELQELIINNFKLSPDRKASNDV
FT                   KYLVNQMKKEVMSGNKTEIALNEMSNLVREKVENMGTDNFVREVTNQMTDSRVTAIKGL
FT                   MKNLPNVMRESIENARSFRSANEILNGNSPLKKFLKEQDNRIKKLFEKKFGTHGMNDLD
FT                   IISRTSGMAAKYEELVDKIMSAYSKYFNTQIRFMDGGNPLLILASKKSIMNLSEVRTYE
FT                   ELVRNPRVFTIELPSFDKDMKVKYGGNRKTSVIRSGIGAKGAYHSTSVTDALNMILDYS
FT                   KKAKELSEIAESIDSKNAFVQIRQGLRYRVERQVDPVSTDASRKFYFDDKGMFDIKSAM
FT                   SDEVRSSKWDITGYAESWYRANSNRLGFSISADIIAQNAIEKGITFFEAMGQRAKGYAI
FT                   AGELLNFAKGASGLKGSMVGINTRSAAKGFVATTNTDTRTYRALGNYYAHTVENPNEPI
FT                   NYRKVDQEVASRVLRNSGKDQSFRTKNSFISSPAFKALDDANEVRGITMQTGYMTNEEI
FT                   ALKLNDANTIMKYKSMIDTAQSKKQITPVEASQMKGSLDKCMISTSEGLAFMDYKLMKA
FT                   FDGMDEVRINMNAEKVMFNNYIEIAIEKEAEKQGLANGLWKEKGITFDKPLEIDINSMF
FT                   NEKNHLTLGKYEINNIKNEIVDERRFKKDDTVSIIGFNTDDINKRSLVLGRQRKTGHGF
FT                   KVVTEGGFHATMTPMLGDIMSDLFGVEGVEQVISYQVEKKGATDLPALIRGYDTQIRQQ
FT                   FSGSVANNKITTDYATEERALSSFYKDVEQMLGIKTTNKDGQYVVDSNFGLDGKQLDYK
FT                   GREKLSSKWMDKLGFNREVFADITMAHEAWDRQGGISRDKVTVKEIGMLDNSDIRTGLY
FT                   GPGESSIYANFMHGMVYRSQTKPEIKAQQKVFKKMVKIVSNYENDWEPKTGDVVIDYTS
FT                   DGTGLMADVNAQMKDGVLHISKDSFEERPRKFGHNQTFTVEDYGKTVINAGLMEFNLES
FT                   GVKGKKIQEHLLSTKGTAYLKLPEFAANQYIPLLDINSMKLPGNVNYVEKTEFLDTLKG
FT                   NYTSIVRKTEEYNDLFTIDKFSASDIATRRGVLETEINREVSHLVANLSNSTSKEGVVE
FT                   RISGNFSRDNLSVFFPHYGINEEKQRNAVMNDITRLHVSDKANNKLAGDVITASEAFFS
FT                   ENSAENLTLGNLYGAKAYEKIRESLKGTGVNNDWGTVKNGELRIGKSEHEKSILASTTS
FT                   STISSVNNTRMRTSAAFMMMAETKKEPFNETEGSSQNAEEVMDNRRAVGPEIFLNEAVP
FT                   IHHTMRNEMNESLSDIATVGKKAFSGSAISLTGDGPIGFGELWATNALMKGTPTPEGLQ
FT                   EMAPVAPKTLGPPTARITPNQNGEYINISVKASASKRMNHNNLAAMINNEIMTMSNVKM
FT                   NTSVNVNDNSKKIDSKWLESAIANAMNKGYAY"
     MEDIKRVPIK NRVLRPINES ADDLGEIRTE NQTEHAAAEY RQSVLAQTYN ELTKDNRIST        60
     LGIWELARTP NNFNVNAQQA LDPFMKLKGD DHVLFFDIEA IGTPEHMRSN KGLDLFAMTE       120
     LSFSGTNFNG KDFVNKKGAI VSMAVAPEKD VYARLKQQIN KLKQNPMMSV SQDVHCTLLD       180
     LTKYTDASKF KSATSNGKSY MSLLGHSRVP SIDTAFTRNT IEEIERGLNN LFYKGTKLED       240
     ALSIFQGHIM SSNAKLGGYN IHHYDLPAIL GIVKDTSTKK FFNDAAKNSL DFFHGYSATV       300
     KNPYSLTGAS LRQEHIYQAL LAKRKIKAGK EAIDGNPPLF LYHLAKDDIQ ANIDIAGFTH       360
     QKIKSFIKGA EESPTYDFSS SAIKKNTLEL GQELFSYQSS YFDKDKYKYN LVGKLGKDGK       420
     SIVPRWGNLN TSLPSNENFV IREFLKDVAL TGTDKKGFGL RLDSKDVKGK ILLLMSETQE       480
     GLAQQIHSSF MPMDDAISRN LRDLKVKHDA SFREYERMFD NNGWEKMKEY YNYLEKAGSV       540
     EEDFDWRSYI IKNGGTEELA MKFPYMVARL EGERDVWGTA ISTLKASGLS DKQKSIALRQ       600
     IKSKLDEKGD NKAQVTAKGN RFLNFNFDKE YNTIFNAKET NSIKDSFRSY INDRRGDRIG       660
     NLEKSYKLAR IDELQELIIN NFKLSPDRKA SNDVKYLVNQ MKKEVMSGNK TEIALNEMSN       720
     LVREKVENMG TDNFVREVTN QMTDSRVTAI KGLMKNLPNV MRESIENARS FRSANEILNG       780
     NSPLKKFLKE QDNRIKKLFE KKFGTHGMND LDIISRTSGM AAKYEELVDK IMSAYSKYFN       840
     TQIRFMDGGN PLLILASKKS IMNLSEVRTY EELVRNPRVF TIELPSFDKD MKVKYGGNRK       900
     TSVIRSGIGA KGAYHSTSVT DALNMILDYS KKAKELSEIA ESIDSKNAFV QIRQGLRYRV       960
     ERQVDPVSTD ASRKFYFDDK GMFDIKSAMS DEVRSSKWDI TGYAESWYRA NSNRLGFSIS      1020
     ADIIAQNAIE KGITFFEAMG QRAKGYAIAG ELLNFAKGAS GLKGSMVGIN TRSAAKGFVA      1080
     TTNTDTRTYR ALGNYYAHTV ENPNEPINYR KVDQEVASRV LRNSGKDQSF RTKNSFISSP      1140
     AFKALDDANE VRGITMQTGY MTNEEIALKL NDANTIMKYK SMIDTAQSKK QITPVEASQM      1200
     KGSLDKCMIS TSEGLAFMDY KLMKAFDGMD EVRINMNAEK VMFNNYIEIA IEKEAEKQGL      1260
     ANGLWKEKGI TFDKPLEIDI NSMFNEKNHL TLGKYEINNI KNEIVDERRF KKDDTVSIIG      1320
     FNTDDINKRS LVLGRQRKTG HGFKVVTEGG FHATMTPMLG DIMSDLFGVE GVEQVISYQV      1380
     EKKGATDLPA LIRGYDTQIR QQFSGSVANN KITTDYATEE RALSSFYKDV EQMLGIKTTN      1440
     KDGQYVVDSN FGLDGKQLDY KGREKLSSKW MDKLGFNREV FADITMAHEA WDRQGGISRD      1500
     KVTVKEIGML DNSDIRTGLY GPGESSIYAN FMHGMVYRSQ TKPEIKAQQK VFKKMVKIVS      1560
     NYENDWEPKT GDVVIDYTSD GTGLMADVNA QMKDGVLHIS KDSFEERPRK FGHNQTFTVE      1620
     DYGKTVINAG LMEFNLESGV KGKKIQEHLL STKGTAYLKL PEFAANQYIP LLDINSMKLP      1680
     GNVNYVEKTE FLDTLKGNYT SIVRKTEEYN DLFTIDKFSA SDIATRRGVL ETEINREVSH      1740
     LVANLSNSTS KEGVVERISG NFSRDNLSVF FPHYGINEEK QRNAVMNDIT RLHVSDKANN      1800
     KLAGDVITAS EAFFSENSAE NLTLGNLYGA KAYEKIRESL KGTGVNNDWG TVKNGELRIG      1860
     KSEHEKSILA STTSSTISSV NNTRMRTSAA FMMMAETKKE PFNETEGSSQ NAEEVMDNRR      1920
     AVGPEIFLNE AVPIHHTMRN EMNESLSDIA TVGKKAFSGS AISLTGDGPI GFGELWATNA      1980
     LMKGTPTPEG LQEMAPVAPK TLGPPTARIT PNQNGEYINI SVKASASKRM NHNNLAAMIN      2040
     NEIMTMSNVK MNTSVNVNDN SKKIDSKWLE SAIANAMNKG YAY                        2083
//

If you have problems or comments...

PBIL Back to PBIL home page