(data stored in ACNUC9435 zone)

EMBL: CP000904.PE283

CP000904.PE283       Location/Qualifiers
FT   CDS             403957..411324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5758"
FT                   /product="nuclease (SNase domain protein)"
FT                   /note="PFAM: nuclease (SNase domain protein)"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5758"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46707"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY6"
FT                   /protein_id="ABY46707.1"
FT                   /translation="MKEKILITSLTRVRKNAPWRVGIYINEGYTFINVGDKGNIATSPR
FT                   FNIFLSEVEKKVSRYPVDVSFYSIEDNREMEVTMMRDQIIYIDCGYNSHRLLSSARFYY
FT                   EKHVLSNPLELAQQKPEENNGLFNVMEKHEESITSSDYIAVGRVEKVTDGDTIDVNLIK
FT                   LSDYLSKHFKVNQTVTIRYNGVDTPEKAQLGAEKYKDPKNAKFGKTYGVTMQDMYTIGE
FT                   EAYKYNETILGGSASQKPLVIIHFDRNKSGDPPKQDAGYGRYIADIYATNEKSADIVFD
FT                   KVKDGTKFVHVNKSLLVKKSAKFPQIPLGLFPFGYANTATVLNPLNWIIELGLKAYDTG
FT                   TGSPSKDPNSDPDIGSPEPYDENINEQEINIGGTTGPTHNALDFFGPYDDRLSVFTNGI
FT                   KTIDDLKRHSKVRIGDVILTIPPISIEVNKTANISKIKTLRTKSSVLVNRGQSLTTLSM
FT                   DLYFHDIESINGKKYPWKKEYAKGEEAKHFYVDGLRPLLAQFAKAPFLPIDNYYINDVL
FT                   GIRDVALMNIEVTTVPNFPESLTAKLTLVEFNSEAYLMDKSTLGDSINYPMLRWYYNQS
FT                   LAGRGDKYRFFKGLEGPIKSDIKFTLADETFLATRKHAIDYMKNADSPEQRKVELETKN
FT                   TDYKNRKEDASVVKEILDQYYRYKDFDIKKHTIIDYFSKPGLDKASTSIQGLIRDKYKI
FT                   KKEEAENAIVEAGELFSNIYDNKYKDVNTILMHKEIFLPYESRLFYKIRFDWNFLESFN
FT                   NRYDEDPSVVYDKKQYQGKEKDGLIILKKLKDAGSQKILENKFKEFYEKETFRIPANDT
FT                   AIDALKKIAEGAKKMEEEVAKYKGEFDEYMKVIEASERMIPMKEYPISGKVIPISINAR
FT                   FSNEFSMAHVLSSEAASLQYMGGGDPYIDLILEVDESGARDFNNLISTSDYYAKTYNQG
FT                   ITNGYIGIENDLAQLFGIRYVMFESISVNTVPSFPGRYQIMLQGIAFDKTQRQREELTA
FT                   LPGNSKQMDLETLKNNKTAFANDRMIEARLHKLEVYPDMELPTYSQINDVLPEIDAGAK
FT                   EYPNLTGGTYLDPDFYFSTGNTLRQLIESSYQGNHQVNMFDATGVAAYTSNMSTDKLFD
FT                   TTEEDWEKLKALQETEGVEPIGWVFKWGQEQEAAKSDTPNTSAGPVMADQGGTASVKNA
FT                   DVQKFLTEKKDDEFAYETFPTMEEWKTLFPDGGNDYSTLAKDPSGDEALIYQEIDSLVD
FT                   KYFKKYYSFPDFIEECRGDLKDADKSKKLVSYQPAEDLYYASFNANRNKLHDANIGMVS
FT                   DLIKKGTIKEPKKTDRMDSKDFHKTEVKITKERFMTLMKAFLDKTSQWKHFKGKIPTVS
FT                   KAGRVGIAQVDVSSGDMKVDEVKRLMYNWRYNLQTAVKQLAEHYEKLNKLDKDCENFEV
FT                   ICRPWDGMFALYEKPDAKIKFAKDIEDNSFASGVISRFNHYATKPFNTFSGYNKDVYKG
FT                   KANLSMDEYITIGNGNKDDYVDKLLELEYYDLSVLKENKLKVDSDKKNIKKVMKEHLEK
FT                   MDKDELFSTYQKHLKFLYELSKQDSKIEKTVDFFGKWSLPNLVTWGKAGKMVDKATDVI
FT                   AGSKKDKNGYEYSRKIFEKAAKLYESIIDVDKTATASTESTDTRLYNDVDPRVLYEEMF
FT                   YDLRYHDQRGRMLRAFPGFQMFIIHEGDYFGKYKFWDNMYGFNAIQSIDVHRSRKIAAD
FT                   TAVISMTNVYSNLTTRRTDVDYADREMKWWDNYIWNEIPQDLIDKKENEIHKNLFLETG
FT                   ARIHLRMGYGATASDLPIVFNGTISELELGDVIEIVAQGDGIELGNVVSGDPEDTNDGL
FT                   FQVTEPRDLICSLMSSKGSWAKDFMNGVVDERLFKDNPLGIMHFGQPFDSNGSIDSKPL
FT                   GNLVWFNDNYGEVAQNIYSSNGTPTFSQWLHPNGERNNIFEDFSWKRLWDNKFKIFNPG
FT                   DEDNVVLKLYNNTVWDIIQSITYSTPDYIAAVHPFELRSTLFFGKPYWRCAFEYGSRYE
FT                   FEAADKTWKRYLTSQPKRPYMQNKFYMSAYDIIENNIKASEDNIFTNVIVNYDGKQTPV
FT                   LYADADIRYDKQKTRVVEADIVAKFGDFYTSEVMATHFGHSTLRDSMKDMYKGNLLVLG
FT                   DPTAKPHDMMYINDEINDLQGNALIKSVTHHFSMETGFITSIEPDLLVVNDDQVILEMS
FT                   KWYMSFGQSVAATLAIRAAANKAGRNMTKWITKSNSIPAKVGKWVSTKGLRHTVRMANS
FT                   DGDMDKILKTLDDIISKEDGDVKALQQKLAKDFEEAAQKVTKEVGEEAGKAAGKAAGKT
FT                   AGKTAFIKNTSKQALLKSGAAFAKVLSNSDDIAKIGKGAVGIIRGAASFTPVGLIVNAS
FT                   IWIGTEMLFEHYRRFKENLQCVVAMPLTYRGKELTAGINNHAGMIYGDAPGRYDVMFNA
FT                   KFGDDNGEDFFGSSLIKLANFFTGSGGEDGVYAKTEKARQLNELSKKQQQ"
     MKEKILITSL TRVRKNAPWR VGIYINEGYT FINVGDKGNI ATSPRFNIFL SEVEKKVSRY        60
     PVDVSFYSIE DNREMEVTMM RDQIIYIDCG YNSHRLLSSA RFYYEKHVLS NPLELAQQKP       120
     EENNGLFNVM EKHEESITSS DYIAVGRVEK VTDGDTIDVN LIKLSDYLSK HFKVNQTVTI       180
     RYNGVDTPEK AQLGAEKYKD PKNAKFGKTY GVTMQDMYTI GEEAYKYNET ILGGSASQKP       240
     LVIIHFDRNK SGDPPKQDAG YGRYIADIYA TNEKSADIVF DKVKDGTKFV HVNKSLLVKK       300
     SAKFPQIPLG LFPFGYANTA TVLNPLNWII ELGLKAYDTG TGSPSKDPNS DPDIGSPEPY       360
     DENINEQEIN IGGTTGPTHN ALDFFGPYDD RLSVFTNGIK TIDDLKRHSK VRIGDVILTI       420
     PPISIEVNKT ANISKIKTLR TKSSVLVNRG QSLTTLSMDL YFHDIESING KKYPWKKEYA       480
     KGEEAKHFYV DGLRPLLAQF AKAPFLPIDN YYINDVLGIR DVALMNIEVT TVPNFPESLT       540
     AKLTLVEFNS EAYLMDKSTL GDSINYPMLR WYYNQSLAGR GDKYRFFKGL EGPIKSDIKF       600
     TLADETFLAT RKHAIDYMKN ADSPEQRKVE LETKNTDYKN RKEDASVVKE ILDQYYRYKD       660
     FDIKKHTIID YFSKPGLDKA STSIQGLIRD KYKIKKEEAE NAIVEAGELF SNIYDNKYKD       720
     VNTILMHKEI FLPYESRLFY KIRFDWNFLE SFNNRYDEDP SVVYDKKQYQ GKEKDGLIIL       780
     KKLKDAGSQK ILENKFKEFY EKETFRIPAN DTAIDALKKI AEGAKKMEEE VAKYKGEFDE       840
     YMKVIEASER MIPMKEYPIS GKVIPISINA RFSNEFSMAH VLSSEAASLQ YMGGGDPYID       900
     LILEVDESGA RDFNNLISTS DYYAKTYNQG ITNGYIGIEN DLAQLFGIRY VMFESISVNT       960
     VPSFPGRYQI MLQGIAFDKT QRQREELTAL PGNSKQMDLE TLKNNKTAFA NDRMIEARLH      1020
     KLEVYPDMEL PTYSQINDVL PEIDAGAKEY PNLTGGTYLD PDFYFSTGNT LRQLIESSYQ      1080
     GNHQVNMFDA TGVAAYTSNM STDKLFDTTE EDWEKLKALQ ETEGVEPIGW VFKWGQEQEA      1140
     AKSDTPNTSA GPVMADQGGT ASVKNADVQK FLTEKKDDEF AYETFPTMEE WKTLFPDGGN      1200
     DYSTLAKDPS GDEALIYQEI DSLVDKYFKK YYSFPDFIEE CRGDLKDADK SKKLVSYQPA      1260
     EDLYYASFNA NRNKLHDANI GMVSDLIKKG TIKEPKKTDR MDSKDFHKTE VKITKERFMT      1320
     LMKAFLDKTS QWKHFKGKIP TVSKAGRVGI AQVDVSSGDM KVDEVKRLMY NWRYNLQTAV      1380
     KQLAEHYEKL NKLDKDCENF EVICRPWDGM FALYEKPDAK IKFAKDIEDN SFASGVISRF      1440
     NHYATKPFNT FSGYNKDVYK GKANLSMDEY ITIGNGNKDD YVDKLLELEY YDLSVLKENK      1500
     LKVDSDKKNI KKVMKEHLEK MDKDELFSTY QKHLKFLYEL SKQDSKIEKT VDFFGKWSLP      1560
     NLVTWGKAGK MVDKATDVIA GSKKDKNGYE YSRKIFEKAA KLYESIIDVD KTATASTEST      1620
     DTRLYNDVDP RVLYEEMFYD LRYHDQRGRM LRAFPGFQMF IIHEGDYFGK YKFWDNMYGF      1680
     NAIQSIDVHR SRKIAADTAV ISMTNVYSNL TTRRTDVDYA DREMKWWDNY IWNEIPQDLI      1740
     DKKENEIHKN LFLETGARIH LRMGYGATAS DLPIVFNGTI SELELGDVIE IVAQGDGIEL      1800
     GNVVSGDPED TNDGLFQVTE PRDLICSLMS SKGSWAKDFM NGVVDERLFK DNPLGIMHFG      1860
     QPFDSNGSID SKPLGNLVWF NDNYGEVAQN IYSSNGTPTF SQWLHPNGER NNIFEDFSWK      1920
     RLWDNKFKIF NPGDEDNVVL KLYNNTVWDI IQSITYSTPD YIAAVHPFEL RSTLFFGKPY      1980
     WRCAFEYGSR YEFEAADKTW KRYLTSQPKR PYMQNKFYMS AYDIIENNIK ASEDNIFTNV      2040
     IVNYDGKQTP VLYADADIRY DKQKTRVVEA DIVAKFGDFY TSEVMATHFG HSTLRDSMKD      2100
     MYKGNLLVLG DPTAKPHDMM YINDEINDLQ GNALIKSVTH HFSMETGFIT SIEPDLLVVN      2160
     DDQVILEMSK WYMSFGQSVA ATLAIRAAAN KAGRNMTKWI TKSNSIPAKV GKWVSTKGLR      2220
     HTVRMANSDG DMDKILKTLD DIISKEDGDV KALQQKLAKD FEEAAQKVTK EVGEEAGKAA      2280
     GKAAGKTAGK TAFIKNTSKQ ALLKSGAAFA KVLSNSDDIA KIGKGAVGII RGAASFTPVG      2340
     LIVNASIWIG TEMLFEHYRR FKENLQCVVA MPLTYRGKEL TAGINNHAGM IYGDAPGRYD      2400
     VMFNAKFGDD NGEDFFGSSL IKLANFFTGS GGEDGVYAKT EKARQLNELS KKQQQ           2455
//

If you have problems or comments...

PBIL Back to PBIL home page