(data stored in ACNUC9435 zone)

EMBL: CP000904.PE284

CP000904.PE284       Location/Qualifiers
FT   CDS             411420..413507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5759"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: N-acetylmuramoyl-L-alanine amidase family 2;
FT                   Lytic transglycosylase catalytic; KEGG: noc:Noc_1884
FT                   peptidase C14, caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5759"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46708"
FT                   /db_xref="GOA:A9VUY7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY7"
FT                   /protein_id="ABY46708.1"
FT                   /translation="MTEKEKPKDKPKTNDKQTYNIETYVKKIKAAKEVYEERKKFLQSF
FT                   SLKKKKEKPKADGGEVAAASGGGSVNFNGELPTVAQYTGPDVYTDKLLNGGVYQNGLKG
FT                   KVAGTDQWNQHIKEQAAKAGVNPLMIKVIMATESGGDHVKTPNSSNCVGLMQTEKEITG
FT                   NLGLDFGKACNDPVYNIYVGCMILKSKHDYAGGVISRGKNPYSDYKSLGYELKQNGHGV
FT                   AWLYNGFSVPLDGKNKVYRGGYVYANQVTAMYKGFGRDAYTDTILTLDVLSGGGGGGGS
FT                   SSSAGGKGTGGKWEYGKTFASGAEVVKFLDTVDTTTINGIYVHHTWDPDHTKAKGVSLA
FT                   TLNDNMRRFHTQTNGWDDIAQHFTIGVDGQVILGRNITSVPCSAKNYNGTDANHPAMYE
FT                   MIGNFDKGKDVLQGKQLESAVAIAKYFSGRPNGVKFHREGLINGQEPKSCPGTGVDKNW
FT                   FMGLVNGGAKASAFSVQSAPLSDNEIEENFAAGCDLYQDPVREKAVEYTAKLPPTGEEL
FT                   AFARSFSAKISIPVAKLKESRIVAPEYTRSSYVEDFKMSSSYDMKKNYSPLSPNEFIHL
FT                   NGPQDNFYTSEARQAFRLLKDRLGYRTLRIARGFDPSDGESSHSIGISMDIYADSTEEA
FT                   VYIADTAWIIGFRSIAVGPNFVHVDIGPEAVWGYDKLPIYRGPGTLKAGAFRYGYKQAN
FT                   L"
     MTEKEKPKDK PKTNDKQTYN IETYVKKIKA AKEVYEERKK FLQSFSLKKK KEKPKADGGE        60
     VAAASGGGSV NFNGELPTVA QYTGPDVYTD KLLNGGVYQN GLKGKVAGTD QWNQHIKEQA       120
     AKAGVNPLMI KVIMATESGG DHVKTPNSSN CVGLMQTEKE ITGNLGLDFG KACNDPVYNI       180
     YVGCMILKSK HDYAGGVISR GKNPYSDYKS LGYELKQNGH GVAWLYNGFS VPLDGKNKVY       240
     RGGYVYANQV TAMYKGFGRD AYTDTILTLD VLSGGGGGGG SSSSAGGKGT GGKWEYGKTF       300
     ASGAEVVKFL DTVDTTTING IYVHHTWDPD HTKAKGVSLA TLNDNMRRFH TQTNGWDDIA       360
     QHFTIGVDGQ VILGRNITSV PCSAKNYNGT DANHPAMYEM IGNFDKGKDV LQGKQLESAV       420
     AIAKYFSGRP NGVKFHREGL INGQEPKSCP GTGVDKNWFM GLVNGGAKAS AFSVQSAPLS       480
     DNEIEENFAA GCDLYQDPVR EKAVEYTAKL PPTGEELAFA RSFSAKISIP VAKLKESRIV       540
     APEYTRSSYV EDFKMSSSYD MKKNYSPLSP NEFIHLNGPQ DNFYTSEARQ AFRLLKDRLG       600
     YRTLRIARGF DPSDGESSHS IGISMDIYAD STEEAVYIAD TAWIIGFRSI AVGPNFVHVD       660
     IGPEAVWGYD KLPIYRGPGT LKAGAFRYGY KQANL                                  695
//

If you have problems or comments...

PBIL Back to PBIL home page