(data stored in ACNUC9435 zone)

EMBL: CP000904.PE285

CP000904.PE285       Location/Qualifiers
FT   CDS             413482..414813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5760"
FT                   /product="peptidase M23B"
FT                   /note="PFAM: peptidase M23B; KEGG: sen:SACE_6672
FT                   metalloendopeptidase-like membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5760"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY8"
FT                   /protein_id="ABY46709.1"
FT                   /translation="MATNKQTFNIEVYKRKIKAGKEEYAKRKEFLAKFNLPKLNDDEEE
FT                   VEEKPSDDSKKTEDQGNAVKEPDGGVGNFTGSGELSVPAEPKSYRFTSVMGARWGTTHN
FT                   GVDLAPNTPGDTNCKILSAGDGVVLQARSGVGGFGTWIVIKHKDDLYTIYGHMHPSTLK
FT                   VKSGDAVKRGQHIANMGMQGESTGVHLHFEVCTDFVNNRRGTTKNPEDYVNVRASASKI
FT                   EVNSFAPQAKFSAKADTKEEGNEKTMHPHYDNDGAELSEEEKLIDQTYRSSFPYLPVQF
FT                   IGDSIKKNDITREFFLLNRVGWARTTKYEKMVSLHKERFIHSEKYDGHEGNLYSPDAKR
FT                   LFESLLLKTQKPYFEVISGFRFSNDGQLSPHEAGCAIDILVKSIDEVREIADCAWLLGV
FT                   RSIAIGGDFENNKGFIHLDIAPKGKDFMYDGVPIYGGPGKWVTQ"
     MATNKQTFNI EVYKRKIKAG KEEYAKRKEF LAKFNLPKLN DDEEEVEEKP SDDSKKTEDQ        60
     GNAVKEPDGG VGNFTGSGEL SVPAEPKSYR FTSVMGARWG TTHNGVDLAP NTPGDTNCKI       120
     LSAGDGVVLQ ARSGVGGFGT WIVIKHKDDL YTIYGHMHPS TLKVKSGDAV KRGQHIANMG       180
     MQGESTGVHL HFEVCTDFVN NRRGTTKNPE DYVNVRASAS KIEVNSFAPQ AKFSAKADTK       240
     EEGNEKTMHP HYDNDGAELS EEEKLIDQTY RSSFPYLPVQ FIGDSIKKND ITREFFLLNR       300
     VGWARTTKYE KMVSLHKERF IHSEKYDGHE GNLYSPDAKR LFESLLLKTQ KPYFEVISGF       360
     RFSNDGQLSP HEAGCAIDIL VKSIDEVREI ADCAWLLGVR SIAIGGDFEN NKGFIHLDIA       420
     PKGKDFMYDG VPIYGGPGKW VTQ                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page