(data stored in ACNUC9435 zone)

EMBL: CP000904.PE286

CP000904.PE286       Location/Qualifiers
FT   CDS             414810..415175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5761"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5761"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUY9"
FT                   /protein_id="ABY46710.1"
FT                   /translation="MNFNSQIHQSIYSKVVVPSLNRLQGTIEGYVIQVDYTKLTCEVVY
FT                   SDENSHALRTMKNVSLPKDGDGVFTQAVKNGDRVSISFKNKSKESPYISTVYKSNHSEE
FT                   NYMSPYGGRTIRQSRIF"
     MNFNSQIHQS IYSKVVVPSL NRLQGTIEGY VIQVDYTKLT CEVVYSDENS HALRTMKNVS        60
     LPKDGDGVFT QAVKNGDRVS ISFKNKSKES PYISTVYKSN HSEENYMSPY GGRTIRQSRI       120
     F                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page