(data stored in ACNUC9435 zone)

EMBL: CP000904.PE287

CP000904.PE287       Location/Qualifiers
FT   CDS             415190..415759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5762"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5762"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46711"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ0"
FT                   /protein_id="ABY46711.1"
FT                   /translation="MNEAYVNKTYGDGDKDIHYPYWRQVLQSELVNFKAKSLEKELENW
FT                   QFISEDEIALKHPVTGSTFKLCDDGSIEMFVNEDTGIRLDTKENGIIFYGDSIHFATKE
FT                   MRMHTKPYGFIWNNHNLNPYLYYGDKVGEERNIPKASMVSTLQDGQANINVPLFQEQKR
FT                   KHYYDQKVTSMIEDLGIETSRIKRGG"
     MNEAYVNKTY GDGDKDIHYP YWRQVLQSEL VNFKAKSLEK ELENWQFISE DEIALKHPVT        60
     GSTFKLCDDG SIEMFVNEDT GIRLDTKENG IIFYGDSIHF ATKEMRMHTK PYGFIWNNHN       120
     LNPYLYYGDK VGEERNIPKA SMVSTLQDGQ ANINVPLFQE QKRKHYYDQK VTSMIEDLGI       180
     ETSRIKRGG                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page