(data stored in ACNUC9435 zone)

EMBL: CP000904.PE288

CP000904.PE288       Location/Qualifiers
FT   CDS             415763..416251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5763"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5763"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46712"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ1"
FT                   /protein_id="ABY46712.1"
FT                   /translation="MKVDFRFSPEGDLELGSPSYNDFDELLYVDSVGNISTDSSEGLLI
FT                   RDIPLQVSYLSEKQVILNRLRTDNPDWFIHKDIGADLSELIGLPNTRETGELGKTLIEK
FT                   SLTDDKFILPADLDVRPVPVSSSEILFYITVKRKVTDLVMPVLFNLEHGLLSEYEVNS"
     MKVDFRFSPE GDLELGSPSY NDFDELLYVD SVGNISTDSS EGLLIRDIPL QVSYLSEKQV        60
     ILNRLRTDNP DWFIHKDIGA DLSELIGLPN TRETGELGKT LIEKSLTDDK FILPADLDVR       120
     PVPVSSSEIL FYITVKRKVT DLVMPVLFNL EHGLLSEYEV NS                          162
//

If you have problems or comments...

PBIL Back to PBIL home page