(data stored in ACNUC9435 zone)

EMBL: CP000904.PE289

CP000904.PE289       Location/Qualifiers
FT   CDS             416251..417051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5764"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5764"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46713"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ2"
FT                   /protein_id="ABY46713.1"
FT                   /translation="MRKSKDEMLEDVLTRLRTDGGITETSPGSIARMFSEVMIDEFSPF
FT                   YDELELIIQMGFVSTSTGGYLDLIGELLNCTRDGDESDDNYRARISNQVSVEQNANLIA
FT                   IRLKTLRIDGVADAQFKRFTRGTGSFTCYVTPQVYPIENDLLTRVESIIDEVAAYGMNV
FT                   EVKTSEYNPVDITLNLIFHSKTTSLERQHIRNKVIQNVGAYMKQLNMGSPIIINEIIQR
FT                   VMETSEQILDMEFKKLVVNEKEYFIKNVEPSLEERYFLRKINVA"
     MRKSKDEMLE DVLTRLRTDG GITETSPGSI ARMFSEVMID EFSPFYDELE LIIQMGFVST        60
     STGGYLDLIG ELLNCTRDGD ESDDNYRARI SNQVSVEQNA NLIAIRLKTL RIDGVADAQF       120
     KRFTRGTGSF TCYVTPQVYP IENDLLTRVE SIIDEVAAYG MNVEVKTSEY NPVDITLNLI       180
     FHSKTTSLER QHIRNKVIQN VGAYMKQLNM GSPIIINEII QRVMETSEQI LDMEFKKLVV       240
     NEKEYFIKNV EPSLEERYFL RKINVA                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page