(data stored in ACNUC9435 zone)

EMBL: CP000904.PE3

CP000904.PE3         Location/Qualifiers
FT   CDS             2748..4931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5435"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5435"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46427"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ5"
FT                   /protein_id="ABY46427.1"
FT                   /translation="MAKRPEGLSPNFNSIVSPDVPSSFIFSWTFIKENSSDYQKDAEVK
FT                   VYKTGSNTALITFSSGTDNQVDITSHQGVLDPEQNYEWEVKVTAANNSTAFSGRKRFKF
FT                   GNIFLQDGLVWPDGPDAYEYIGTRKYFNEIKENAASVLEDYVIDSREENDALEKALALF
FT                   TRETVPSRTDFENLESILWLIAKKESTYQDEIQRLIEDGLGAQDIHKIYTLFDRLVKIP
FT                   PKEPSNVYLSFGGFEKLYVKEGKAYNNGKEDLSVDINWKPSDLKSGTCTINFLNELTED
FT                   VSYYRVELEVGFTDEACTHTLLYRVEDIDSLGRKIDIPMDHISFVHLSSSKETRYVLRV
FT                   YAVDKRRKQSTNYYKPYNVNNVPLGVASYNLRVQQNDLSNQWAIQYYHDIYNGPNTAYV
FT                   HNVTGNVDGIYHYAVRVFDINGSVSDWYWFPEQIKIDPLKPPSAPKPYLNWSTQTELEF
FT                   AWSAVPTAEYYEYIPTWWQNPSTQRENGLTTKHIWLNYDTTYVQKVRAVNRAGASPWVT
FT                   VSGRTKPRPIVEAYQKGAGSRTWRTDYVIYKQNGQVRKNSSEWRYEYDDNEVFHGEWVE
FT                   LRNKIQDGMAVKKGTRWGNNKCLFFLDHNDWRQKLQGKEILDVQLYIRRRNTEHGYPED
FT                   GRFLHVWAHNYAGKWDLPSGSDGPDLNNHQKIERIDFNRGESHWISLNKSFGEGLRDGW
FT                   IKGVAFYHPGADYGPYSYMRFDAYTFQFYVKYR"
     MAKRPEGLSP NFNSIVSPDV PSSFIFSWTF IKENSSDYQK DAEVKVYKTG SNTALITFSS        60
     GTDNQVDITS HQGVLDPEQN YEWEVKVTAA NNSTAFSGRK RFKFGNIFLQ DGLVWPDGPD       120
     AYEYIGTRKY FNEIKENAAS VLEDYVIDSR EENDALEKAL ALFTRETVPS RTDFENLESI       180
     LWLIAKKEST YQDEIQRLIE DGLGAQDIHK IYTLFDRLVK IPPKEPSNVY LSFGGFEKLY       240
     VKEGKAYNNG KEDLSVDINW KPSDLKSGTC TINFLNELTE DVSYYRVELE VGFTDEACTH       300
     TLLYRVEDID SLGRKIDIPM DHISFVHLSS SKETRYVLRV YAVDKRRKQS TNYYKPYNVN       360
     NVPLGVASYN LRVQQNDLSN QWAIQYYHDI YNGPNTAYVH NVTGNVDGIY HYAVRVFDIN       420
     GSVSDWYWFP EQIKIDPLKP PSAPKPYLNW STQTELEFAW SAVPTAEYYE YIPTWWQNPS       480
     TQRENGLTTK HIWLNYDTTY VQKVRAVNRA GASPWVTVSG RTKPRPIVEA YQKGAGSRTW       540
     RTDYVIYKQN GQVRKNSSEW RYEYDDNEVF HGEWVELRNK IQDGMAVKKG TRWGNNKCLF       600
     FLDHNDWRQK LQGKEILDVQ LYIRRRNTEH GYPEDGRFLH VWAHNYAGKW DLPSGSDGPD       660
     LNNHQKIERI DFNRGESHWI SLNKSFGEGL RDGWIKGVAF YHPGADYGPY SYMRFDAYTF       720
     QFYVKYR                                                                 727
//

If you have problems or comments...

PBIL Back to PBIL home page