(data stored in ACNUC9435 zone)

EMBL: CP000904.PE31

CP000904.PE31        Location/Qualifiers
FT   CDS             complement(52656..52790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bca:BCE_2637 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5464"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46455"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV23"
FT                   /protein_id="ABY46455.1"
FT                   /translation="MNLSIQDELLPFAEELQRYVTPVFLEELAREIGFIKRKRKFSGS"
     MNLSIQDELL PFAEELQRYV TPVFLEELAR EIGFIKRKRK FSGS                         44
//

If you have problems or comments...

PBIL Back to PBIL home page