(data stored in ACNUC9435 zone)

EMBL: CP000904.PE32

CP000904.PE32        Location/Qualifiers
FT   CDS             53323..54732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5465"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bsu:BG12750 similar to histidine permease"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5465"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46456"
FT                   /db_xref="GOA:A9VV24"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV24"
FT                   /protein_id="ABY46456.1"
FT                   /translation="MENKNGREFQRKMQARHLVMLSLGGVIGTGLFLSSGYTIQQAGPF
FT                   GTILSYLIGALVVYLVMLCLGELSVHMPETGAFHSYAVKYIGPGTGYTVAWLYWLTWTV
FT                   ALGSEFTAAGLLMKRWFPSINVWVWSALFAILIFVLNVLTVKFFAESEFWFSSIKVIAI
FT                   VIFIVLGVAAMLGFLPMTHSKAAPFFSNFTSGGLFPHGATAIIMTMLAVNFAFSGTELI
FT                   GIAAGETANPEKMIPKAIRTTLWRLIIFFVGTIVVLSALLPISDAGVLESPFVAVLERI
FT                   GVPYSADIMNFVILTAILSAANSGLYASSRMLWSLANKNTISPIFGKMTKQGIPINAVI
FT                   FSMVGGALALLSSIVAPDTVYIVLVSISGLAVVVVWMSISASQFLFRRQFLKEGNSEKD
FT                   LIYRTPLYPLVPIASFILCLASCIGIAFDPTQRIALYCCIPFILFCYGSYYLTKNLKKR
FT                   GVDYVEQNQPN"
     MENKNGREFQ RKMQARHLVM LSLGGVIGTG LFLSSGYTIQ QAGPFGTILS YLIGALVVYL        60
     VMLCLGELSV HMPETGAFHS YAVKYIGPGT GYTVAWLYWL TWTVALGSEF TAAGLLMKRW       120
     FPSINVWVWS ALFAILIFVL NVLTVKFFAE SEFWFSSIKV IAIVIFIVLG VAAMLGFLPM       180
     THSKAAPFFS NFTSGGLFPH GATAIIMTML AVNFAFSGTE LIGIAAGETA NPEKMIPKAI       240
     RTTLWRLIIF FVGTIVVLSA LLPISDAGVL ESPFVAVLER IGVPYSADIM NFVILTAILS       300
     AANSGLYASS RMLWSLANKN TISPIFGKMT KQGIPINAVI FSMVGGALAL LSSIVAPDTV       360
     YIVLVSISGL AVVVVWMSIS ASQFLFRRQF LKEGNSEKDL IYRTPLYPLV PIASFILCLA       420
     SCIGIAFDPT QRIALYCCIP FILFCYGSYY LTKNLKKRGV DYVEQNQPN                   469
//

If you have problems or comments...

PBIL Back to PBIL home page