(data stored in ACNUC9435 zone)

EMBL: CP000904.PE34

CP000904.PE34        Location/Qualifiers
FT   CDS             56801..58402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5468"
FT                   /product="N-acetylmuramoyl-L-alanine amidase family 2"
FT                   /note="PFAM: S-layer domain protein;
FT                   N-acetylmuramoyl-L-alanine amidase family 2; SH3 type 3
FT                   domain protein; SMART: SH3 domain protein; KEGG:
FT                   btk:BT9727_3111 N-acetylmuramoyl-L-alanine amidase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5468"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46458"
FT                   /db_xref="GOA:A9VV26"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV26"
FT                   /protein_id="ABY46458.1"
FT                   /translation="MNIRFNKKVVAFTAGLTVLSSPLVSFAEEQQLVNNKQPTNVQEQS
FT                   KTTSDEQALKSIEASFEEVDGRGGGTVDNKKVDSLQRSEGIHEETGTLTVPNNSNRTKR
FT                   SLSPISPSTSSTINGVPFTEWIVPAGNDNIRPQNYMSPKYITIHETDNTSVGAGARNHA
FT                   QYLYNQAVGNTDRAASWHFTVDDKEIYQHLPLNENGWHAGDGDGPGNRESIAIEIAVNS
FT                   DGNYSKAVDNAKKLVAYLMKETGVPLNNIVKHQRWSGKICPANMINNGQWDAFVNGVGG
FT                   YYNNLYQPKDDITGGWYEEAIRELNRRGIMIGEGNGVFAPNRAITRAEFAQLISKSLNL
FT                   PAGDASFKDLNDANSTLRDGIKRAASAGIILGRGDGYFDPNTPITREESAIIVNKALQY
FT                   KGIWGPVVNLPFSDKDQISYKEDVQRLYGLGIVRGKGDNQYDPKGTTTRGETATFILNM
FT                   LQVIENGSVEKVIGTAQINGIGVNVRSGSGTNYSIVRKTSKGEKVTVYEEKNGWLRIGT
FT                   GQWIYYDSSYIDYNRL"
     MNIRFNKKVV AFTAGLTVLS SPLVSFAEEQ QLVNNKQPTN VQEQSKTTSD EQALKSIEAS        60
     FEEVDGRGGG TVDNKKVDSL QRSEGIHEET GTLTVPNNSN RTKRSLSPIS PSTSSTINGV       120
     PFTEWIVPAG NDNIRPQNYM SPKYITIHET DNTSVGAGAR NHAQYLYNQA VGNTDRAASW       180
     HFTVDDKEIY QHLPLNENGW HAGDGDGPGN RESIAIEIAV NSDGNYSKAV DNAKKLVAYL       240
     MKETGVPLNN IVKHQRWSGK ICPANMINNG QWDAFVNGVG GYYNNLYQPK DDITGGWYEE       300
     AIRELNRRGI MIGEGNGVFA PNRAITRAEF AQLISKSLNL PAGDASFKDL NDANSTLRDG       360
     IKRAASAGII LGRGDGYFDP NTPITREESA IIVNKALQYK GIWGPVVNLP FSDKDQISYK       420
     EDVQRLYGLG IVRGKGDNQY DPKGTTTRGE TATFILNMLQ VIENGSVEKV IGTAQINGIG       480
     VNVRSGSGTN YSIVRKTSKG EKVTVYEEKN GWLRIGTGQW IYYDSSYIDY NRL              533
//

If you have problems or comments...

PBIL Back to PBIL home page