(data stored in ACNUC9435 zone)

EMBL: CP000904.PE35

CP000904.PE35        Location/Qualifiers
FT   CDS             59163..60353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5469"
FT                   /product="2-alkenal reductase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: bcy:Bcer98_2249 2-alkenal reductase; PFAM:
FT                   peptidase S1 and S6 chymotrypsin/Hap; SMART: PDZ/DHR/GLGF
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5469"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46459"
FT                   /db_xref="GOA:A9VV27"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV27"
FT                   /protein_id="ABY46459.1"
FT                   /translation="MGHYDTKQTRKNKSRDGKKTGYFFIGIIGAMIGSITIGLTTPYID
FT                   EIKGSTGQSAKNNEVNQVTPISHKPEGVNSLQNMIEDAKEVVVGVINYKQNADSFNTQD
FT                   QSEEAGSGSGVIYKKNGNKAFIVTNNHVIDGANKVEVKLNNGKKVPAKVVGTDSLLDLA
FT                   VLEIDGTDVKRVATLGDSDKNRTGETVIAIGNPLGLEGSVTKGIISSKEREIPVSTLGN
FT                   QQVDWQAQVIQTDAAINPGNSGGALFNEQGEVIGINSSKIAQQAVEGIGFAIPINIAKT
FT                   TLGFLEKDGTVKRPMMGVQLLDVEKMTDSARNQLKLPKEISNGAVLGNISNQSPAEKGG
FT                   LQQHDVVIALDEQKIENVVQFRKYLYEKKKSGDTIKVTVYRNGEKITKMVKLTEQK"
     MGHYDTKQTR KNKSRDGKKT GYFFIGIIGA MIGSITIGLT TPYIDEIKGS TGQSAKNNEV        60
     NQVTPISHKP EGVNSLQNMI EDAKEVVVGV INYKQNADSF NTQDQSEEAG SGSGVIYKKN       120
     GNKAFIVTNN HVIDGANKVE VKLNNGKKVP AKVVGTDSLL DLAVLEIDGT DVKRVATLGD       180
     SDKNRTGETV IAIGNPLGLE GSVTKGIISS KEREIPVSTL GNQQVDWQAQ VIQTDAAINP       240
     GNSGGALFNE QGEVIGINSS KIAQQAVEGI GFAIPINIAK TTLGFLEKDG TVKRPMMGVQ       300
     LLDVEKMTDS ARNQLKLPKE ISNGAVLGNI SNQSPAEKGG LQQHDVVIAL DEQKIENVVQ       360
     FRKYLYEKKK SGDTIKVTVY RNGEKITKMV KLTEQK                                 396
//

If you have problems or comments...

PBIL Back to PBIL home page