(data stored in ACNUC9435 zone)

EMBL: CP000904.PE36

CP000904.PE36        Location/Qualifiers
FT   CDS             complement(60579..61982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5470"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: bca:BCE_2750 histidine
FT                   kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5470"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46460"
FT                   /db_xref="GOA:A9VV28"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV28"
FT                   /protein_id="ABY46460.1"
FT                   /translation="MKMKRITYKLFMTTSLILLAFAVMIYLTLYFFLPTFYEQYKTEQL
FT                   ENGMEEIIDKSKNLTFQNAQPLFEEYMQKNNAILRFPDYERVSVYSTPYTFIQGSVTQA
FT                   ARIGGSNSLNKSYDIPFQDGNQTVIVYATFQPIDEASKVLVRFLPYISIIVVVIGIGSA
FT                   YLFSRFITKPLIYINRGAQKMADLDFSEKIEIRSMDELGELSNSLNDMSINLQQTMFDL
FT                   QKANQQLKSDIEKEREIETKRREFFATVSHELKTPLTIMKGYLEGMIYNIGPYQDRDQY
FT                   LKKNHQIIEKMENLVREILSMSKLEQHTFKLQLKEINLSELMDIITKDLSFFASQKDIQ
FT                   IIKQIDSNLSVYTDRALLEKACKNIIHNAIMYSPNSENVYIQLTQDSKQKCILIQIINT
FT                   GVQIKENDIQHVFEPFYRIEKSRNRNTGGSGLGLYIVKQIFEALGIEYCINNVEQGVQF
FT                   VVSIPISEQ"
     MKMKRITYKL FMTTSLILLA FAVMIYLTLY FFLPTFYEQY KTEQLENGME EIIDKSKNLT        60
     FQNAQPLFEE YMQKNNAILR FPDYERVSVY STPYTFIQGS VTQAARIGGS NSLNKSYDIP       120
     FQDGNQTVIV YATFQPIDEA SKVLVRFLPY ISIIVVVIGI GSAYLFSRFI TKPLIYINRG       180
     AQKMADLDFS EKIEIRSMDE LGELSNSLND MSINLQQTMF DLQKANQQLK SDIEKEREIE       240
     TKRREFFATV SHELKTPLTI MKGYLEGMIY NIGPYQDRDQ YLKKNHQIIE KMENLVREIL       300
     SMSKLEQHTF KLQLKEINLS ELMDIITKDL SFFASQKDIQ IIKQIDSNLS VYTDRALLEK       360
     ACKNIIHNAI MYSPNSENVY IQLTQDSKQK CILIQIINTG VQIKENDIQH VFEPFYRIEK       420
     SRNRNTGGSG LGLYIVKQIF EALGIEYCIN NVEQGVQFVV SIPISEQ                     467
//

If you have problems or comments...

PBIL Back to PBIL home page