(data stored in ACNUC9435 zone)

EMBL: CP000904.PE37

CP000904.PE37        Location/Qualifiers
FT   CDS             complement(61996..62661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5471"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bca:BCE_2749 transcription
FT                   response regulator-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5471"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46461"
FT                   /db_xref="GOA:A9VV29"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV29"
FT                   /protein_id="ABY46461.1"
FT                   /translation="MINHHILVIEDDQEIQELIKQFLLTQQYTVEVASDGLEGMIQFNK
FT                   QSFDLILLDVMMPNLNGFEVAKMIRSQSNVPVIMLTALEEEQDQMKGFDLGIDDYITKP
FT                   FSFHVLIRRVEAVLRRSNDKSLDNHFVFKELRVDVDAYKVYVNEVEISLTTKEFEILQL
FT                   LLQNEKRVLPRESIVEKVWGYDYIGESRIIDTHMKNIRKKLDIPYIKTIKGIGYKIDE"
     MINHHILVIE DDQEIQELIK QFLLTQQYTV EVASDGLEGM IQFNKQSFDL ILLDVMMPNL        60
     NGFEVAKMIR SQSNVPVIML TALEEEQDQM KGFDLGIDDY ITKPFSFHVL IRRVEAVLRR       120
     SNDKSLDNHF VFKELRVDVD AYKVYVNEVE ISLTTKEFEI LQLLLQNEKR VLPRESIVEK       180
     VWGYDYIGES RIIDTHMKNI RKKLDIPYIK TIKGIGYKID E                           221
//

If you have problems or comments...

PBIL Back to PBIL home page