(data stored in ACNUC9435 zone)

EMBL: CP000904.PE38

CP000904.PE38        Location/Qualifiers
FT   CDS             64534..66897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5472"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; Carbohydrate-binding family V/XII; Fibronectin
FT                   type III domain protein; KEGG: btl:BALH_3389 serine
FT                   protease, subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5472"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46462"
FT                   /db_xref="GOA:A9VV30"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004954"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034073"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV30"
FT                   /protein_id="ABY46462.1"
FT                   /translation="MKFIKGIFVSTIALTAFTGLELIKFHENPNVVYADSKGPVKNISQ
FT                   SEADIKEEDQIIVKFKSEVNFPYKDGLEKQIKNEDSDLELVKIFSEFPQLTLKRLFTSV
FT                   DPKEIENIDKHTRETENNSSSNLLDYYIVEVPNKVTAETLMDKFKKSYLVEEVYMQEKP
FT                   TLLPEVQLPTVSLNPYDDPRFLNQGYLKEAPYGINASYAWSIKGGDGKGTTFVDMEYGW
FT                   LLDHEDLVNQKVELISGRNIDQHVGHGTSVLGIVSAEDNKVGNIGIASKAKVKVVSQIR
FT                   GDGSYNTADAIINAVHNLQAGDILLLEAQASYDGYGDKYLPVEVQPDIFDAIRAGTDKG
FT                   IIVIEAGANGSNDLDQFRDRNGKQVLNRNSPDFKDSGAIMIGAASSTVPHKRLWFSNYG
FT                   SRIDVYGWGENVDTTRAEPNRITKNLYTTGFSGTSSASPIIAGAATSIQGVAKEHLGRP
FT                   YKPAELRNILSNPNTGTKSQNPLTDKIGVLPDLKSILSNLGYSPDISNNVLEGNQFVWS
FT                   MKGIGDFEFAKLDFNKTKEEMQIQLKAGVPHHYFDSTYASVKVQNSSGKVVYNKDIYGN
FT                   RQQNAETQKISMKVGDYIEFTHLEGGNRATLINVDKNIQESFGKKIVYQVTVNGLKKVD
FT                   QIINPSPDTEAPTRPEGLQAANITANSVELKWNSSTDNVGVKEYQVLRDGKFIQMVQGT
FT                   TFTDSKLTANIEYKYTVKAIDAAGNQSIQSSVLSIKTKEQNTSYEKWDPRKAYTKGDRV
FT                   EYQGKIYEAVQSYQGNGDSNWIFSLSLWKTISIS"
     MKFIKGIFVS TIALTAFTGL ELIKFHENPN VVYADSKGPV KNISQSEADI KEEDQIIVKF        60
     KSEVNFPYKD GLEKQIKNED SDLELVKIFS EFPQLTLKRL FTSVDPKEIE NIDKHTRETE       120
     NNSSSNLLDY YIVEVPNKVT AETLMDKFKK SYLVEEVYMQ EKPTLLPEVQ LPTVSLNPYD       180
     DPRFLNQGYL KEAPYGINAS YAWSIKGGDG KGTTFVDMEY GWLLDHEDLV NQKVELISGR       240
     NIDQHVGHGT SVLGIVSAED NKVGNIGIAS KAKVKVVSQI RGDGSYNTAD AIINAVHNLQ       300
     AGDILLLEAQ ASYDGYGDKY LPVEVQPDIF DAIRAGTDKG IIVIEAGANG SNDLDQFRDR       360
     NGKQVLNRNS PDFKDSGAIM IGAASSTVPH KRLWFSNYGS RIDVYGWGEN VDTTRAEPNR       420
     ITKNLYTTGF SGTSSASPII AGAATSIQGV AKEHLGRPYK PAELRNILSN PNTGTKSQNP       480
     LTDKIGVLPD LKSILSNLGY SPDISNNVLE GNQFVWSMKG IGDFEFAKLD FNKTKEEMQI       540
     QLKAGVPHHY FDSTYASVKV QNSSGKVVYN KDIYGNRQQN AETQKISMKV GDYIEFTHLE       600
     GGNRATLINV DKNIQESFGK KIVYQVTVNG LKKVDQIINP SPDTEAPTRP EGLQAANITA       660
     NSVELKWNSS TDNVGVKEYQ VLRDGKFIQM VQGTTFTDSK LTANIEYKYT VKAIDAAGNQ       720
     SIQSSVLSIK TKEQNTSYEK WDPRKAYTKG DRVEYQGKIY EAVQSYQGNG DSNWIFSLSL       780
     WKTISIS                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page