(data stored in ACNUC9435 zone)

EMBL: CP000904.PE39

CP000904.PE39        Location/Qualifiers
FT   CDS             67752..68225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5473"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5473"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46463"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV31"
FT                   /protein_id="ABY46463.1"
FT                   /translation="MKTFGKILLTGTLALGGLTVMNVETPKAQAEGASEFCRYICGPKE
FT                   TLNNFTIQLSDTEYRMGQNIILRATNDNAYDVTYKATVEKQYATGWGYVETDFNYQSML
FT                   PAGTNEDFNVWTFDGNSAGNLNEAGTYRMKIEVTHADGKTDTVYTAPITLLAQ"
     MKTFGKILLT GTLALGGLTV MNVETPKAQA EGASEFCRYI CGPKETLNNF TIQLSDTEYR        60
     MGQNIILRAT NDNAYDVTYK ATVEKQYATG WGYVETDFNY QSMLPAGTNE DFNVWTFDGN       120
     SAGNLNEAGT YRMKIEVTHA DGKTDTVYTA PITLLAQ                                157
//

If you have problems or comments...

PBIL Back to PBIL home page