(data stored in ACNUC9435 zone)

EMBL: CP000904.PE41

CP000904.PE41        Location/Qualifiers
FT   CDS             68792..68959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5475"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5475"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46465"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV33"
FT                   /protein_id="ABY46465.1"
FT                   /translation="MERRGNVLASANEVLSPTLLAKEKLIGYRDKEPNNALYNAAINIK
FT                   NEAIRLLALA"
     MERRGNVLAS ANEVLSPTLL AKEKLIGYRD KEPNNALYNA AINIKNEAIR LLALA             55
//

If you have problems or comments...

PBIL Back to PBIL home page