(data stored in ACNUC9435 zone)

EMBL: CP000904.PE42

CP000904.PE42        Location/Qualifiers
FT   CDS             complement(69198..69611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5476"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0275 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5476"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46466"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV34"
FT                   /protein_id="ABY46466.1"
FT                   /translation="MKKVILAGALGIAVLSGMNLPGVEATKASAASTNLEIQEITKYYS
FT                   MSSYEVSQKESFNLKKGEELTVFITNSGFPISYTVFDADNQVIGTYNANSPYGRVFTAQ
FT                   KDGNISVQFQAGANSSFMKKMNFTAKFALSKLN"
     MKKVILAGAL GIAVLSGMNL PGVEATKASA ASTNLEIQEI TKYYSMSSYE VSQKESFNLK        60
     KGEELTVFIT NSGFPISYTV FDADNQVIGT YNANSPYGRV FTAQKDGNIS VQFQAGANSS       120
     FMKKMNFTAK FALSKLN                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page