(data stored in ACNUC9435 zone)

EMBL: CP000904.PE43

CP000904.PE43        Location/Qualifiers
FT   CDS             complement(70268..71362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5477"
FT                   /product="tetratricopeptide domain protein"
FT                   /note="KEGG: bcy:Bcer98_0992 tetratricopeptide domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5477"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46467"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR040702"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV35"
FT                   /protein_id="ABY46467.1"
FT                   /translation="MNVQIKGNEQITHLLNEWYQEIRARHVDAAHLLKQEIENKIHDIE
FT                   ENQTILLYYSLLDFRHQYLIDSLSISKDSFKKSDAYETPTDDFLSYYYHFFKAIHSNVM
FT                   GNHSLARIHFDKAESLLSTIPDEIEYAEFHYELAVFYCHTHKSILCINHVMKAKDIFSK
FT                   HMGYELKVAFCNNLYGLACTHLREWELAEEHYISAMDTFQKENLEYNILIVRHNLGFMY
FT                   ATQNLSELALRYLSEVNQKLASDYKALFIEAREHYKLGENQIAQELIEKGLQLSTQLGI
FT                   ESYIHHFNILKKMNLNSCAIDVEKAILEGISYFEREELYEYINEYTEKLATQFYKENNH
FT                   VKASYYFYEASKASEKNYIKGALK"
     MNVQIKGNEQ ITHLLNEWYQ EIRARHVDAA HLLKQEIENK IHDIEENQTI LLYYSLLDFR        60
     HQYLIDSLSI SKDSFKKSDA YETPTDDFLS YYYHFFKAIH SNVMGNHSLA RIHFDKAESL       120
     LSTIPDEIEY AEFHYELAVF YCHTHKSILC INHVMKAKDI FSKHMGYELK VAFCNNLYGL       180
     ACTHLREWEL AEEHYISAMD TFQKENLEYN ILIVRHNLGF MYATQNLSEL ALRYLSEVNQ       240
     KLASDYKALF IEAREHYKLG ENQIAQELIE KGLQLSTQLG IESYIHHFNI LKKMNLNSCA       300
     IDVEKAILEG ISYFEREELY EYINEYTEKL ATQFYKENNH VKASYYFYEA SKASEKNYIK       360
     GALK                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page