(data stored in ACNUC9435 zone)

EMBL: CP000904.PE44

CP000904.PE44        Location/Qualifiers
FT   CDS             71671..71964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5478"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG: bcy:Bcer98_1906
FT                   regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5478"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46468"
FT                   /db_xref="GOA:A9VV36"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV36"
FT                   /protein_id="ABY46468.1"
FT                   /translation="MIALKNDRNVKEISEENVDLLKVMAHPVRLQIVNELMHHKKCNVT
FT                   QLTEILRLPQSTVSQHLSKLRRTVLRTERRGLEVHYYIDNAKARQIVGILGL"
     MIALKNDRNV KEISEENVDL LKVMAHPVRL QIVNELMHHK KCNVTQLTEI LRLPQSTVSQ        60
     HLSKLRRTVL RTERRGLEVH YYIDNAKARQ IVGILGL                                 97
//

If you have problems or comments...

PBIL Back to PBIL home page