(data stored in ACNUC9435 zone)

EMBL: CP000904.PE46

CP000904.PE46        Location/Qualifiers
FT   CDS             73493..74314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5480"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bcz:pE33L466_0280 possible Zn-dependent hydrolase,
FT                   including glyoxylases"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5480"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46470"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV38"
FT                   /protein_id="ABY46470.1"
FT                   /translation="MFKTIDTNLNDVKLTVFSSDEKSFMVTATLVEKAGHAFLINSKFT
FT                   QSDSKEIVDYLKNNNLSLDKIFIIHGDPDYYFGLESIKAAYPGAIAYATESTVEHIVHS
FT                   VLGKLKVWKDVLGENAPNNVVLPQVIKEKTIDFQGLTFELVGLDDYRTSLFNKELKLLI
FT                   GGIDVFNEIHVFLADTSSKAAMEAWIENLKVLQALNADIIVPSHGSIEKSLDNQAIIAT
FT                   MDYLRTAIQASEESKTSKDFVAKLETAYPGYANKGVLELSAKVVTKEMPWG"
     MFKTIDTNLN DVKLTVFSSD EKSFMVTATL VEKAGHAFLI NSKFTQSDSK EIVDYLKNNN        60
     LSLDKIFIIH GDPDYYFGLE SIKAAYPGAI AYATESTVEH IVHSVLGKLK VWKDVLGENA       120
     PNNVVLPQVI KEKTIDFQGL TFELVGLDDY RTSLFNKELK LLIGGIDVFN EIHVFLADTS       180
     SKAAMEAWIE NLKVLQALNA DIIVPSHGSI EKSLDNQAII ATMDYLRTAI QASEESKTSK       240
     DFVAKLETAY PGYANKGVLE LSAKVVTKEM PWG                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page