(data stored in ACNUC9435 zone)

EMBL: CP000904.PE47

CP000904.PE47        Location/Qualifiers
FT   CDS             74319..74711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5481"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5481"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46471"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV39"
FT                   /protein_id="ABY46471.1"
FT                   /translation="MNKYQKLLHETYVLTGEGKMDAFKAYLNENVSWTEAAGFPYAGTY
FT                   IGPDEVVKNVHERLGTEWDNYSAKDEIYAFNNNTVIVYGKYSGTYKVTGKSFIADFCHL
FT                   YEFDENDKVKKFIQIVDSATVNEVLS"
     MNKYQKLLHE TYVLTGEGKM DAFKAYLNEN VSWTEAAGFP YAGTYIGPDE VVKNVHERLG        60
     TEWDNYSAKD EIYAFNNNTV IVYGKYSGTY KVTGKSFIAD FCHLYEFDEN DKVKKFIQIV       120
     DSATVNEVLS                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page