(data stored in ACNUC9435 zone)

EMBL: CP000904.PE48

CP000904.PE48        Location/Qualifiers
FT   CDS             74866..75393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5482"
FT                   /product="protein of unknown function DUF1486"
FT                   /note="PFAM: protein of unknown function DUF1486; KEGG:
FT                   bcz:pE33L466_0282 possible pyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5482"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46472"
FT                   /db_xref="GOA:A9VV40"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV40"
FT                   /protein_id="ABY46472.1"
FT                   /translation="MKLEKNLIIIIISVFILGIVSTLTFQSFIGNAKGNSIKSENVAPV
FT                   SKDDVAEKEKNKKMVVDFYNEVFNKHNIDIIPKYVSEDYKQHNPFVADGRKAFMDFFKE
FT                   DFVKNPNSSAEIKRVVAEGDTVALHVHSRANSQDKGVAIVDIFRIKDGKIVEHWDVIQE
FT                   ISNETANNNTMF"
     MKLEKNLIII IISVFILGIV STLTFQSFIG NAKGNSIKSE NVAPVSKDDV AEKEKNKKMV        60
     VDFYNEVFNK HNIDIIPKYV SEDYKQHNPF VADGRKAFMD FFKEDFVKNP NSSAEIKRVV       120
     AEGDTVALHV HSRANSQDKG VAIVDIFRIK DGKIVEHWDV IQEISNETAN NNTMF            175
//

If you have problems or comments...

PBIL Back to PBIL home page