(data stored in ACNUC9435 zone)

EMBL: CP000904.PE49

CP000904.PE49        Location/Qualifiers
FT   CDS             complement(75695..76003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5483"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46473"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV41"
FT                   /protein_id="ABY46473.1"
FT                   /translation="MDNSKWISLSNVNDEEEIWAGARVRLYNVGMNREDKENDFYEYII
FT                   SYIYDNDNYLQLTNLTTGKAGYIICVIEKELPNNYALGKTLKQRMGLENTYFRFEYE"
     MDNSKWISLS NVNDEEEIWA GARVRLYNVG MNREDKENDF YEYIISYIYD NDNYLQLTNL        60
     TTGKAGYIIC VIEKELPNNY ALGKTLKQRM GLENTYFRFE YE                          102
//

If you have problems or comments...

PBIL Back to PBIL home page