(data stored in ACNUC9435 zone)

EMBL: CP000904.PE5

CP000904.PE5         Location/Qualifiers
FT   CDS             8379..10856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5437"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5437"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46429"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ7"
FT                   /protein_id="ABY46429.1"
FT                   /translation="MFTNSGKIIKHATIPGAITFQSAGYVSISNELYEDSKVVFSFSKP
FT                   TEKVALIPKYLSDGNFLFASLDKENKLHIGGIVKDSEKIYGVVDVKDNILDSNTLTVSS
FT                   NGSHFTVTLNNKTVLKFESALFVNGQVRVYGEIGEVFNSCEIQEPQSTAWTSNANGGGV
FT                   EAKTIKIEDHDYVKLVGSATKKAMFSQSISLLAKDYTLSFNAQGNGEYLIKSGETILKQ
FT                   IAISKGELSYISQTFNLATPQTITLVFQTSEILIVGKHQLEDRVDPTSYIPNPSISSSA
FT                   TRKGSALKFPVKNLFDKKAGSIYLKLTTKNRMDRDQTIFCSDTREMSLSVHGTNLSYTV
FT                   GASSITLPKTLEGNTSYEFLCSWNDEGIELTVNGENAKALNTGLLLTTPQELIFANEET
FT                   PIQEEVVLEEWALFNNKLPANSNIKAQLPFAVMQSLFDGGISGQNVTWSEIPVAPIDHS
FT                   PILVQKENGDTLQKVSFFNHETAAYQTWNQEAFQYDGKSDFVEVAYNNLDEQFRDIAIR
FT                   TEDGEKIGEPYRIDGKRFYFSLHTNRKAVLKSKTLYATYQVNDTYTIDYNIKAVDGYRI
FT                   DFAKHDGGKRIVYQEGNRYGEPKKLATMIDMNPIQNQNHEGFLYITNTINKTDSFRITA
FT                   TPDRLHADGASFSTLIIEPLDYQGNFLSHSNLEIIASKGFVSRHISRDAVEAQKRSGQY
FT                   LYQYHAPYIQSKRAGEIVEDYIWITDKDNNIGVCYKMLLSPVSKPDKVQLTQVEKNLLT
FT                   AKTKIINYLLMYEGVERYEDEVLFSILDFNQDGRVTMDEILVLETNQKDNELTVILNKL
FT                   KEWEDTNHAVATS"
     MFTNSGKIIK HATIPGAITF QSAGYVSISN ELYEDSKVVF SFSKPTEKVA LIPKYLSDGN        60
     FLFASLDKEN KLHIGGIVKD SEKIYGVVDV KDNILDSNTL TVSSNGSHFT VTLNNKTVLK       120
     FESALFVNGQ VRVYGEIGEV FNSCEIQEPQ STAWTSNANG GGVEAKTIKI EDHDYVKLVG       180
     SATKKAMFSQ SISLLAKDYT LSFNAQGNGE YLIKSGETIL KQIAISKGEL SYISQTFNLA       240
     TPQTITLVFQ TSEILIVGKH QLEDRVDPTS YIPNPSISSS ATRKGSALKF PVKNLFDKKA       300
     GSIYLKLTTK NRMDRDQTIF CSDTREMSLS VHGTNLSYTV GASSITLPKT LEGNTSYEFL       360
     CSWNDEGIEL TVNGENAKAL NTGLLLTTPQ ELIFANEETP IQEEVVLEEW ALFNNKLPAN       420
     SNIKAQLPFA VMQSLFDGGI SGQNVTWSEI PVAPIDHSPI LVQKENGDTL QKVSFFNHET       480
     AAYQTWNQEA FQYDGKSDFV EVAYNNLDEQ FRDIAIRTED GEKIGEPYRI DGKRFYFSLH       540
     TNRKAVLKSK TLYATYQVND TYTIDYNIKA VDGYRIDFAK HDGGKRIVYQ EGNRYGEPKK       600
     LATMIDMNPI QNQNHEGFLY ITNTINKTDS FRITATPDRL HADGASFSTL IIEPLDYQGN       660
     FLSHSNLEII ASKGFVSRHI SRDAVEAQKR SGQYLYQYHA PYIQSKRAGE IVEDYIWITD       720
     KDNNIGVCYK MLLSPVSKPD KVQLTQVEKN LLTAKTKIIN YLLMYEGVER YEDEVLFSIL       780
     DFNQDGRVTM DEILVLETNQ KDNELTVILN KLKEWEDTNH AVATS                       825
//

If you have problems or comments...

PBIL Back to PBIL home page