(data stored in ACNUC9435 zone)

EMBL: CP000904.PE50

CP000904.PE50        Location/Qualifiers
FT   CDS             complement(76032..77060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5484"
FT                   /product="Insertion element protein"
FT                   /note="PFAM: Insertion element protein; KEGG: gtn:GTNG_0770
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5484"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46474"
FT                   /db_xref="InterPro:IPR024442"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV42"
FT                   /protein_id="ABY46474.1"
FT                   /translation="MSKAFSNLLKHIGNLSHTEKEQVFQWVKRYVEPSSSVGGRLINEM
FT                   RETRFKEGFECPHCASEHVVRFGKHNNRQRYRCKCCSKTFTDTTNTVLYRTRKGNEWIT
FT                   FVDCMFKGYSLRKSAEIVGVTWVTLFYWRHKLLSALKQLDFEKFEGIVEVDETYFLYSQ
FT                   KGQRGISERKPRRRGGKSKHRGISHEQVCVLVARDRTKATVSKIACMGRVVKTKVDSMI
FT                   GSKLTSDNVLVTDAWRAYKTYAKEKGIEHYRIKSNDGKHVIKGLYHIQNVNGLHSRMKQ
FT                   WIDRFKGVATKYLDNYLAWFLFIDRKSNESTKHNIKEFLLTSFVFEMTDTYDSLRLSKF
FT                   SV"
     MSKAFSNLLK HIGNLSHTEK EQVFQWVKRY VEPSSSVGGR LINEMRETRF KEGFECPHCA        60
     SEHVVRFGKH NNRQRYRCKC CSKTFTDTTN TVLYRTRKGN EWITFVDCMF KGYSLRKSAE       120
     IVGVTWVTLF YWRHKLLSAL KQLDFEKFEG IVEVDETYFL YSQKGQRGIS ERKPRRRGGK       180
     SKHRGISHEQ VCVLVARDRT KATVSKIACM GRVVKTKVDS MIGSKLTSDN VLVTDAWRAY       240
     KTYAKEKGIE HYRIKSNDGK HVIKGLYHIQ NVNGLHSRMK QWIDRFKGVA TKYLDNYLAW       300
     FLFIDRKSNE STKHNIKEFL LTSFVFEMTD TYDSLRLSKF SV                          342
//

If you have problems or comments...

PBIL Back to PBIL home page