(data stored in ACNUC9435 zone)

EMBL: CP000904.PE51

CP000904.PE51        Location/Qualifiers
FT   CDS             78259..78669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5485"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcz:pE33L466_0278 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5485"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46475"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV43"
FT                   /protein_id="ABY46475.1"
FT                   /translation="MNMKTFEMREKRLAELLGAKVLWEFISAVTEEIEKQELESTPGLL
FT                   EDLFIHVKETIQIQNMNQGITKAPVKTEADGIDKDTLFMEAYVELINHKFVISELVVEL
FT                   SSVLKELNCFVQSSLPLLQNKLDSQESQSASL"
     MNMKTFEMRE KRLAELLGAK VLWEFISAVT EEIEKQELES TPGLLEDLFI HVKETIQIQN        60
     MNQGITKAPV KTEADGIDKD TLFMEAYVEL INHKFVISEL VVELSSVLKE LNCFVQSSLP       120
     LLQNKLDSQE SQSASL                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page