(data stored in ACNUC9435 zone)

EMBL: CP000904.PE52

CP000904.PE52        Location/Qualifiers
FT   CDS             complement(79494..80138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5486"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5486"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46476"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV44"
FT                   /protein_id="ABY46476.1"
FT                   /translation="MNIELLDTHHVKDAAHLLAHSFVNNEPLVSSLQIPFASFHKMCEE
FT                   MMKQAVSQAMSFVAIENFQIVGVLLTKKVTQPLIDTDKATELCPQMEPIFQLLDTLETE
FT                   SIEFSHLDKEKLVYLDMGACHPDWMGSGIVTSLISHAIQEISKKDFDFIAACTNKISQK
FT                   ILKKLFTTLEMNEIVYSNFPYKEAYPFANTTTSLAAQLLYIPQSQFVIKAI"
     MNIELLDTHH VKDAAHLLAH SFVNNEPLVS SLQIPFASFH KMCEEMMKQA VSQAMSFVAI        60
     ENFQIVGVLL TKKVTQPLID TDKATELCPQ MEPIFQLLDT LETESIEFSH LDKEKLVYLD       120
     MGACHPDWMG SGIVTSLISH AIQEISKKDF DFIAACTNKI SQKILKKLFT TLEMNEIVYS       180
     NFPYKEAYPF ANTTTSLAAQ LLYIPQSQFV IKAI                                   214
//

If you have problems or comments...

PBIL Back to PBIL home page