(data stored in ACNUC9435 zone)

EMBL: CP000904.PE54

CP000904.PE54        Location/Qualifiers
FT   CDS             83671..90990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5489"
FT                   /product="amino acid adenylation domain"
FT                   /note="TIGRFAM: amino acid adenylation domain; PFAM:
FT                   AMP-dependent synthetase and ligase; condensation domain
FT                   protein; NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   phosphopantetheine-binding; Male sterility domain; KEGG:
FT                   rso:RS05859 probable peptide synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5489"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46478"
FT                   /db_xref="GOA:A9VV46"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR010080"
FT                   /db_xref="InterPro:IPR013120"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV46"
FT                   /protein_id="ABY46478.1"
FT                   /translation="MKEIQKQYEIVEELDATVGQEALWIAHQMELENGMNNEATIIKLK
FT                   GNLQIDTFKKALTLIVQSHPALRTLFIKRDEKIKQFIQKSIDFDIPIKDLTAFKNTEQK
FT                   FILKKFLDSIVNEKFNLEEGPLFKFHIIKLCEDEFILHMIFHHIIYDGCSLGIFIQQLS
FT                   HTYCELLQENTGLVLESPYKSLIEFEEGFIDSAIYREGSSYWKDYLQGELPPTEFPATI
FT                   NKMNEPIYTNENISKNIDADLFYQIQCFAKRNNISVYRVMLSTYCALLHQMTNAEEIIV
FT                   GIPINTRPHTEEGNAFGYFVNTLPIRITIEKGDTFKGILNKVNKSVHLAIKYKHNPYSH
FT                   IVKDSNLNNNTHHNMIYSTAFNTVRIPQLKILDIESTVLTDCKRVNPFNMTWRIMRYEG
FT                   ETENKIEVDYNSALYKAESISDLVERYIYLLQELMKNVNELIHSLDLLLKKDHRLYKDI
FT                   NSNTLAYPNSKTLDQLIDLQALKSPNQIAISMGDKSITYYDLQQRSNQIANYLRENDIK
FT                   KGQRVSITMVREIDTIVWILGILKSGGVYVPIDPKFPEKRIEYILKDSESQMIITKKEF
FT                   RGLIESFAIHTIYLEDFHYANSIENIVPTHTIEDTAYIIYTSGSTGLPKGVGVPHKGVI
FT                   NLSYSLMNQFNLDKNDVFLQFATMIFDASIMEIFPILLCGGRMHLISEMEKRSAEEFIN
FT                   VINKNGITYVLLPTAFFKLIADMPKEMLLTLNSLKCVFVGGETIPAESVRKWQSKLGLK
FT                   IPVLNAYGPTEATVCTTIYEVNHEIKEENSNIPIGKPIANSKVFVVSPFNTICPSGVVG
FT                   ELFIGGDGVAKGYINQKEKTEEAFISFGESYNRDKKMYRTGDLVRLLPSGKIDRKKLEL
FT                   QIPSLLENMKNQYVPPISETEKRLVKTWSEILNLGKYRISRDDDFFKLGGHSLIAVQVL
FT                   NQIQKEFHLKIEIRDIFEHTTIASLSAYIDKLMEVNTDREEHDMQVLKVADKECYKLSS
FT                   AQKRIWFLNKYNAINRVYDTQLHINIEPSLKKNILQDAIRFLVERHEMLRTVFIEKNGE
FT                   PRQVILKSISIDLIHDDIEHITKKEQQEYIRRTINQTDHTPFDLENGPLFRIRIFNLDK
FT                   KRSYIYINLHHIITDEWSVRNLLDELMKVYNAFANRRNPYLPTISNRYVDYVEWEHKQL
FT                   KLGRWDTEKSYWMTELAAPLPILNLPLDFSRDRQSTNKGKVFEMKLDNKMKESLKQVCE
FT                   QENVSMYMLFLAVYIQLLHYLTDQKDIIVGTPVAGRNYQEFEQIQGFFVNTLAIRTQLN
FT                   DVKNLKQLVQVVKEKCLNSFQNQSYPFDKVIEQINPDRSFGNNPIFSTMFSYQKDILQQ
FT                   HDEHKLQLLTNKQDVSKFDISLSVEEGLDYVGISFEYDINLFKEESINRFTQNLLNILD
FT                   AFIHQRTVAYETLSFLSQEEVSLYRKVNHTERPYPYFQNIQEQFYKQVDRQSNRIAIAT
FT                   ETESLTYRQLNMDSNQVAQHLLEKGIKTGDKVAIFLDRSINSIVSMIGILKAGAAYIPI
FT                   DVKYPEDRINYIVSDSEACRIITNNKYKSHLNSSNYNVSIIEDIYRTTINDDVKILNKP
FT                   DDLAYVIYTSGSTGKPKGTLLTHKGVLNLAEWRNEVFHISPNDKVTQFYSHSFDSSVSE
FT                   IFSTLLNGAELYLLSDEQRYSTVAYAQAIQEIQATLSDVPTVFFNELSTSLTKLDSEKI
FT                   RSLRFMIMGGEAASTNAIRSWQNTFKNQVQLVNEYGPTEATVSAMYYFIPILEDENSLL
FT                   GNIPIGIPISNTKVHILNSYMQHCPVGGMGELYIESLGLAQGYWKQEEKTNQAFISSPF
FT                   SEDNSKRVYRTGDLAKWLPNGNIEFMGRKDKQVKIRGHRIELGEIEDALLQFEGISQAV
FT                   ITQTKDGMLLQAYYKTVDGIEIEKNKLAIHLSNVLPEYMIPKYYSHVLEIPITANGKID
FT                   FEKLPEIDFDNEQKDDCILKPQTKVQKNIAKVWSEVLNIKSIGLKDDFFNLGGHSLKVM
FT                   PALVKLKPLYPNLKIQDFFKYRTIENLAYHIEEMEDMSLKNEKNINVACIENETKTNPV
FT                   YKRTKLEECELDMVNYPKAVFLTGATGYLGAHILEQLLQLPSTTIYCLVRKNENQVIDE
FT                   KLKERMRFYFGKEILQKLEERVELIEGDLSLINLGLDPKKVDHLKSNVESIIHCGGEVR
FT                   HYGEREHFQKVNVQSTKYLLELAKNTNARFHYISTLSVVGQAESDPKEFKFFESNFDRG
FT                   QNLDNVYLESKFQGEKMVREAMEKGVRATIYRVGNLVGNSKTGKFQFNINENAFYRLLK
FT                   GICLSNIAPEINTYVDLTPVDYGSLAITELSYKANTVNKTMHICNPTQLKWDQFINSLQ
FT                   VFGYDLMLMRQEKYIEKFFNTNLTTDEQKALELIMPLLESVEELSVAIPSCLYTQGYLK
FT                   NVHCLEPNQEYINLLLNYAMSIEFLPTIKEPILL"
     MKEIQKQYEI VEELDATVGQ EALWIAHQME LENGMNNEAT IIKLKGNLQI DTFKKALTLI        60
     VQSHPALRTL FIKRDEKIKQ FIQKSIDFDI PIKDLTAFKN TEQKFILKKF LDSIVNEKFN       120
     LEEGPLFKFH IIKLCEDEFI LHMIFHHIIY DGCSLGIFIQ QLSHTYCELL QENTGLVLES       180
     PYKSLIEFEE GFIDSAIYRE GSSYWKDYLQ GELPPTEFPA TINKMNEPIY TNENISKNID       240
     ADLFYQIQCF AKRNNISVYR VMLSTYCALL HQMTNAEEII VGIPINTRPH TEEGNAFGYF       300
     VNTLPIRITI EKGDTFKGIL NKVNKSVHLA IKYKHNPYSH IVKDSNLNNN THHNMIYSTA       360
     FNTVRIPQLK ILDIESTVLT DCKRVNPFNM TWRIMRYEGE TENKIEVDYN SALYKAESIS       420
     DLVERYIYLL QELMKNVNEL IHSLDLLLKK DHRLYKDINS NTLAYPNSKT LDQLIDLQAL       480
     KSPNQIAISM GDKSITYYDL QQRSNQIANY LRENDIKKGQ RVSITMVREI DTIVWILGIL       540
     KSGGVYVPID PKFPEKRIEY ILKDSESQMI ITKKEFRGLI ESFAIHTIYL EDFHYANSIE       600
     NIVPTHTIED TAYIIYTSGS TGLPKGVGVP HKGVINLSYS LMNQFNLDKN DVFLQFATMI       660
     FDASIMEIFP ILLCGGRMHL ISEMEKRSAE EFINVINKNG ITYVLLPTAF FKLIADMPKE       720
     MLLTLNSLKC VFVGGETIPA ESVRKWQSKL GLKIPVLNAY GPTEATVCTT IYEVNHEIKE       780
     ENSNIPIGKP IANSKVFVVS PFNTICPSGV VGELFIGGDG VAKGYINQKE KTEEAFISFG       840
     ESYNRDKKMY RTGDLVRLLP SGKIDRKKLE LQIPSLLENM KNQYVPPISE TEKRLVKTWS       900
     EILNLGKYRI SRDDDFFKLG GHSLIAVQVL NQIQKEFHLK IEIRDIFEHT TIASLSAYID       960
     KLMEVNTDRE EHDMQVLKVA DKECYKLSSA QKRIWFLNKY NAINRVYDTQ LHINIEPSLK      1020
     KNILQDAIRF LVERHEMLRT VFIEKNGEPR QVILKSISID LIHDDIEHIT KKEQQEYIRR      1080
     TINQTDHTPF DLENGPLFRI RIFNLDKKRS YIYINLHHII TDEWSVRNLL DELMKVYNAF      1140
     ANRRNPYLPT ISNRYVDYVE WEHKQLKLGR WDTEKSYWMT ELAAPLPILN LPLDFSRDRQ      1200
     STNKGKVFEM KLDNKMKESL KQVCEQENVS MYMLFLAVYI QLLHYLTDQK DIIVGTPVAG      1260
     RNYQEFEQIQ GFFVNTLAIR TQLNDVKNLK QLVQVVKEKC LNSFQNQSYP FDKVIEQINP      1320
     DRSFGNNPIF STMFSYQKDI LQQHDEHKLQ LLTNKQDVSK FDISLSVEEG LDYVGISFEY      1380
     DINLFKEESI NRFTQNLLNI LDAFIHQRTV AYETLSFLSQ EEVSLYRKVN HTERPYPYFQ      1440
     NIQEQFYKQV DRQSNRIAIA TETESLTYRQ LNMDSNQVAQ HLLEKGIKTG DKVAIFLDRS      1500
     INSIVSMIGI LKAGAAYIPI DVKYPEDRIN YIVSDSEACR IITNNKYKSH LNSSNYNVSI      1560
     IEDIYRTTIN DDVKILNKPD DLAYVIYTSG STGKPKGTLL THKGVLNLAE WRNEVFHISP      1620
     NDKVTQFYSH SFDSSVSEIF STLLNGAELY LLSDEQRYST VAYAQAIQEI QATLSDVPTV      1680
     FFNELSTSLT KLDSEKIRSL RFMIMGGEAA STNAIRSWQN TFKNQVQLVN EYGPTEATVS      1740
     AMYYFIPILE DENSLLGNIP IGIPISNTKV HILNSYMQHC PVGGMGELYI ESLGLAQGYW      1800
     KQEEKTNQAF ISSPFSEDNS KRVYRTGDLA KWLPNGNIEF MGRKDKQVKI RGHRIELGEI      1860
     EDALLQFEGI SQAVITQTKD GMLLQAYYKT VDGIEIEKNK LAIHLSNVLP EYMIPKYYSH      1920
     VLEIPITANG KIDFEKLPEI DFDNEQKDDC ILKPQTKVQK NIAKVWSEVL NIKSIGLKDD      1980
     FFNLGGHSLK VMPALVKLKP LYPNLKIQDF FKYRTIENLA YHIEEMEDMS LKNEKNINVA      2040
     CIENETKTNP VYKRTKLEEC ELDMVNYPKA VFLTGATGYL GAHILEQLLQ LPSTTIYCLV      2100
     RKNENQVIDE KLKERMRFYF GKEILQKLEE RVELIEGDLS LINLGLDPKK VDHLKSNVES      2160
     IIHCGGEVRH YGEREHFQKV NVQSTKYLLE LAKNTNARFH YISTLSVVGQ AESDPKEFKF      2220
     FESNFDRGQN LDNVYLESKF QGEKMVREAM EKGVRATIYR VGNLVGNSKT GKFQFNINEN      2280
     AFYRLLKGIC LSNIAPEINT YVDLTPVDYG SLAITELSYK ANTVNKTMHI CNPTQLKWDQ      2340
     FINSLQVFGY DLMLMRQEKY IEKFFNTNLT TDEQKALELI MPLLESVEEL SVAIPSCLYT      2400
     QGYLKNVHCL EPNQEYINLL LNYAMSIEFL PTIKEPILL                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page