(data stored in ACNUC9435 zone)

EMBL: CP000904.PE56

CP000904.PE56        Location/Qualifiers
FT   CDS             92532..93257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5491"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_0037 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5491"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46480"
FT                   /db_xref="GOA:A9VV48"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV48"
FT                   /protein_id="ABY46480.1"
FT                   /translation="MQFIFKSVNSEMRKIGGRKLLLISLFFSLLSSFLCISYFIFNKNH
FT                   PDMFQSTNLIAITVNFNTLTLSIFSACMWYFIISSENKYGTWAIIYTQPISKLKLLVTK
FT                   NLMFILFYLVFNILNFLVMGIYTFINGYEISILYFLKMLILCTILSLAIPYSQLLFHLI
FT                   IKKGILAASLSVVWLFFFITYGLFPLIFTKTFPIFYSLNIVSDVAFKETIILLYLAISS
FT                   IYILGIMLLSVSFKYYTYE"
     MQFIFKSVNS EMRKIGGRKL LLISLFFSLL SSFLCISYFI FNKNHPDMFQ STNLIAITVN        60
     FNTLTLSIFS ACMWYFIISS ENKYGTWAII YTQPISKLKL LVTKNLMFIL FYLVFNILNF       120
     LVMGIYTFIN GYEISILYFL KMLILCTILS LAIPYSQLLF HLIIKKGILA ASLSVVWLFF       180
     FITYGLFPLI FTKTFPIFYS LNIVSDVAFK ETIILLYLAI SSIYILGIML LSVSFKYYTY       240
     E                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page