(data stored in ACNUC9435 zone)

EMBL: CP000904.PE57

CP000904.PE57        Location/Qualifiers
FT   CDS             93273..93986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5492"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckl:CKL_3049 predicted ABC transporter,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5492"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46481"
FT                   /db_xref="GOA:A9VV49"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV49"
FT                   /protein_id="ABY46481.1"
FT                   /translation="MGILGEYKKSLHNGLYILLLVFLLIPISFQVLLTVSSQLKDGVFM
FT                   HIAILSLFCRLFLPIAIGLLVSFSFVNEFRRKGYMSAIYHGITLKTILSNKFLFCLIIT
FT                   FGYLLCALIITSIPIVLTVDNLGTVYQSLSFSILFMVISSLIIVNLHFLINIIFYKIPL
FT                   LSLLVGVIGGLGSFFISHTNYWILFPWSYPIMSLYIDSIETKQLYIILFVYLLSLLSCI
FT                   LMLSTLYNKKSMRWN"
     MGILGEYKKS LHNGLYILLL VFLLIPISFQ VLLTVSSQLK DGVFMHIAIL SLFCRLFLPI        60
     AIGLLVSFSF VNEFRRKGYM SAIYHGITLK TILSNKFLFC LIITFGYLLC ALIITSIPIV       120
     LTVDNLGTVY QSLSFSILFM VISSLIIVNL HFLINIIFYK IPLLSLLVGV IGGLGSFFIS       180
     HTNYWILFPW SYPIMSLYID SIETKQLYII LFVYLLSLLS CILMLSTLYN KKSMRWN          237
//

If you have problems or comments...

PBIL Back to PBIL home page