(data stored in ACNUC9435 zone)

EMBL: CP000904.PE58

CP000904.PE58        Location/Qualifiers
FT   CDS             complement(94239..94913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5493"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46482"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUT7"
FT                   /protein_id="ABY46482.1"
FT                   /translation="MKQVLRKSKRKMIYLVGSLLIALSMFATTSFAATEGAVKSVTNSN
FT                   YTGIAADINLPKSVVVKDGYVNWYLGIGASKVEGGISKTSSGYKVFLNSGYNESGQNSK
FT                   YWNTQYDTSIKDGDRVNLKLVNNGNGTVTMYVNGSPKYVNQPVYGTFSQYEPVKMVQGV
FT                   EDTGSNSFSQASFSNVLLRADTSGSTYKSWNSSISSSFSQHGTYGSNFKVYSQVPLSAS
FT                   LR"
     MKQVLRKSKR KMIYLVGSLL IALSMFATTS FAATEGAVKS VTNSNYTGIA ADINLPKSVV        60
     VKDGYVNWYL GIGASKVEGG ISKTSSGYKV FLNSGYNESG QNSKYWNTQY DTSIKDGDRV       120
     NLKLVNNGNG TVTMYVNGSP KYVNQPVYGT FSQYEPVKMV QGVEDTGSNS FSQASFSNVL       180
     LRADTSGSTY KSWNSSISSS FSQHGTYGSN FKVYSQVPLS ASLR                        224
//

If you have problems or comments...

PBIL Back to PBIL home page