(data stored in ACNUC9435 zone)

EMBL: CP000904.PE6

CP000904.PE6         Location/Qualifiers
FT   CDS             10837..15351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5438"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46430"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:A9VUZ8"
FT                   /protein_id="ABY46430.1"
FT                   /translation="MQLQPHKDLVRSGQRNRGYAIRIGNKVPKNSANLAYVQSKSVSPE
FT                   ENILLEDVSSQIKENGLSNFIEKDYMVYPNNKFLLETESGQAIFPTDAVFVTDEFTIRK
FT                   NRQDTPKPVFYQMELKGRFDARTSQVIPYLGGFSSETEQDAIALEDVVLDKRNDLIYVG
FT                   NSIRIEANGGPIQEEDEYKVQLIREDNFIYRIVVVTNFRNDKDVTYKVVYPNYRNDIKQ
FT                   SELKEEVLNAYPFFEQVTMDQFEDIVSQMGSDPDKYKHLKVYAIEEKGNDFSFYATSDV
FT                   MIANYQTRTPQLFKHRVEAKLKTKLSETNPGKMNIGFSFVQSVANVENLSSIGKAINEH
FT                   LSLPKYVELQNPHPTEVDLLKKDIGYWAVNLDMPDHHYEDYDLLVITGYGKADLSMFKD
FT                   KFEHYLKNGGTIWIDNAGSGINVLDFKTSKGNTFVSDIGFSSSSNEFGVKEITKDSPYT
FT                   SRLLPIKNIEALGYTDIAPTILFGQDEESKQWDAVVKHFNGGPSIIKKTLFDKGTVLVS
FT                   NCGIFRSFYHNQKESVNLVLNSILYHSEEQWVFTPWRNDFVYHRDNLFAQEYKVNNTDV
FT                   YINDRSDYNANQIVAKKILYKNCKEYVKIYCKPWFYNAIGTYEHAVNGDKSIPVNNSGF
FT                   ESGQVDSSGKPIVSWTSDTVNAIPSWNTKKLAGQTVTFTHDSDKSLFGVRQVSLNSSNG
FT                   TTGAHAYWESEDIYLSIDDYKVTVWTTIDQVRGVTTDGIKIGVYNLQGEQISSSISITG
FT                   KKDWVKLETNFHIDKPQNIKIRLGFVDGNGLGKASFDNVTLDTIGAVRGVAQNEGEKTL
FT                   YAFSIKPNATTIDIEAEGFGNANITRATPEVSFTYTIMPFILQWISYGIDSGTGLEYGR
FT                   YERMYGPPVSYSKAIRKTDGLKNLGYLHTLLPPVPSGKQWYDKNKIFYKIALGSENLEE
FT                   NNFVNLKLFDRKTGMEWFYSGDLVIGHKDIFWATDKPSFVLHAETGFETIRASKRNFGL
FT                   KLIDDRRIYSELPQTKDAKENWYLRIHNGQFIKDGLGYKEWSELHASNNPAVMNQYKER
FT                   VMKKEKYQIDEYASQIFNPSIGIMTVENEMEYLTPSTVKVPHNNLFVSQGFVEKEQLLV
FT                   EGLANSVGTLFRAKQKDWLRNDKVHIFIDVSNNGNIVEIFEEYPFEINLDEGTVFFPGR
FT                   IITGKVYATYEHRNFRLYKRIYKNTKMSNDLLENKRIDSVTKEVIMYGSKENWLIQPIP
FT                   VLKTTKGKATSANTIPATNYRIDYEKGKVIFKFEPVGPVYADYGYFENQELSANDYDIQ
FT                   NGIFFLKENISFKDDLFAKYSYFDNFYEYKGFYNETLRTFLHLDLNPSVGHYSTLPMTT
FT                   YVNGVQKVEYKNVPSSKLLNKLIHIYIVPDSENGNSIRHCFSREEWRNIQQSNPMYLLL
FT                   AKVQVREHTNVKDVVVMDARTRGGGISASLSTKAIDERVHGRQRYWDIGNWEGKAFYRN
FT                   GVLIVTLPKSILTEYGGTLSEEYAKEAIDKHVAYGTYCIIEWE"
     MQLQPHKDLV RSGQRNRGYA IRIGNKVPKN SANLAYVQSK SVSPEENILL EDVSSQIKEN        60
     GLSNFIEKDY MVYPNNKFLL ETESGQAIFP TDAVFVTDEF TIRKNRQDTP KPVFYQMELK       120
     GRFDARTSQV IPYLGGFSSE TEQDAIALED VVLDKRNDLI YVGNSIRIEA NGGPIQEEDE       180
     YKVQLIREDN FIYRIVVVTN FRNDKDVTYK VVYPNYRNDI KQSELKEEVL NAYPFFEQVT       240
     MDQFEDIVSQ MGSDPDKYKH LKVYAIEEKG NDFSFYATSD VMIANYQTRT PQLFKHRVEA       300
     KLKTKLSETN PGKMNIGFSF VQSVANVENL SSIGKAINEH LSLPKYVELQ NPHPTEVDLL       360
     KKDIGYWAVN LDMPDHHYED YDLLVITGYG KADLSMFKDK FEHYLKNGGT IWIDNAGSGI       420
     NVLDFKTSKG NTFVSDIGFS SSSNEFGVKE ITKDSPYTSR LLPIKNIEAL GYTDIAPTIL       480
     FGQDEESKQW DAVVKHFNGG PSIIKKTLFD KGTVLVSNCG IFRSFYHNQK ESVNLVLNSI       540
     LYHSEEQWVF TPWRNDFVYH RDNLFAQEYK VNNTDVYIND RSDYNANQIV AKKILYKNCK       600
     EYVKIYCKPW FYNAIGTYEH AVNGDKSIPV NNSGFESGQV DSSGKPIVSW TSDTVNAIPS       660
     WNTKKLAGQT VTFTHDSDKS LFGVRQVSLN SSNGTTGAHA YWESEDIYLS IDDYKVTVWT       720
     TIDQVRGVTT DGIKIGVYNL QGEQISSSIS ITGKKDWVKL ETNFHIDKPQ NIKIRLGFVD       780
     GNGLGKASFD NVTLDTIGAV RGVAQNEGEK TLYAFSIKPN ATTIDIEAEG FGNANITRAT       840
     PEVSFTYTIM PFILQWISYG IDSGTGLEYG RYERMYGPPV SYSKAIRKTD GLKNLGYLHT       900
     LLPPVPSGKQ WYDKNKIFYK IALGSENLEE NNFVNLKLFD RKTGMEWFYS GDLVIGHKDI       960
     FWATDKPSFV LHAETGFETI RASKRNFGLK LIDDRRIYSE LPQTKDAKEN WYLRIHNGQF      1020
     IKDGLGYKEW SELHASNNPA VMNQYKERVM KKEKYQIDEY ASQIFNPSIG IMTVENEMEY      1080
     LTPSTVKVPH NNLFVSQGFV EKEQLLVEGL ANSVGTLFRA KQKDWLRNDK VHIFIDVSNN      1140
     GNIVEIFEEY PFEINLDEGT VFFPGRIITG KVYATYEHRN FRLYKRIYKN TKMSNDLLEN      1200
     KRIDSVTKEV IMYGSKENWL IQPIPVLKTT KGKATSANTI PATNYRIDYE KGKVIFKFEP      1260
     VGPVYADYGY FENQELSAND YDIQNGIFFL KENISFKDDL FAKYSYFDNF YEYKGFYNET      1320
     LRTFLHLDLN PSVGHYSTLP MTTYVNGVQK VEYKNVPSSK LLNKLIHIYI VPDSENGNSI      1380
     RHCFSREEWR NIQQSNPMYL LLAKVQVREH TNVKDVVVMD ARTRGGGISA SLSTKAIDER      1440
     VHGRQRYWDI GNWEGKAFYR NGVLIVTLPK SILTEYGGTL SEEYAKEAID KHVAYGTYCI      1500
     IEWE                                                                   1504
//

If you have problems or comments...

PBIL Back to PBIL home page