(data stored in ACNUC9435 zone)

EMBL: CP000904.PE61

CP000904.PE61        Location/Qualifiers
FT   CDS             98101..98661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5496"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gka:GK2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5496"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46485"
FT                   /db_xref="GOA:A9VV53"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV53"
FT                   /protein_id="ABY46485.1"
FT                   /translation="MFNILSTNVFTYKSKDGKTVTIREAKEQDAERMLNCASRALINAP
FT                   YMLSTVEDVKQMSVDAIQKTLKAYYENPNFVQFIAEVDSKLVGAIDFKNGNKEKISHQG
FT                   FFAMTILPEYRNYGIGRALLETLINWAKNNCKIEKVCLEVMEDNLGAIKLYKNQGFFEE
FT                   GRKAKGVKLDGGYQDLILMALFV"
     MFNILSTNVF TYKSKDGKTV TIREAKEQDA ERMLNCASRA LINAPYMLST VEDVKQMSVD        60
     AIQKTLKAYY ENPNFVQFIA EVDSKLVGAI DFKNGNKEKI SHQGFFAMTI LPEYRNYGIG       120
     RALLETLINW AKNNCKIEKV CLEVMEDNLG AIKLYKNQGF FEEGRKAKGV KLDGGYQDLI       180
     LMALFV                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page