(data stored in ACNUC9435 zone)

EMBL: CP000904.PE63

CP000904.PE63        Location/Qualifiers
FT   CDS             100656..101048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oih:OB0471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5498"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46487"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV55"
FT                   /protein_id="ABY46487.1"
FT                   /translation="MYNDSIYFPYINYDQCFDRQFPGPQIPGIPGMPGFPGVPSFPGQQ
FT                   SSQAPTSPPPSFIPQQSTASPFAVDPGAISLCLFRNTYIWLSNGEQFWYFPIFVGPRSV
FT                   AGFRWNGRFWVIFGIDTRRIISFTCF"
     MYNDSIYFPY INYDQCFDRQ FPGPQIPGIP GMPGFPGVPS FPGQQSSQAP TSPPPSFIPQ        60
     QSTASPFAVD PGAISLCLFR NTYIWLSNGE QFWYFPIFVG PRSVAGFRWN GRFWVIFGID       120
     TRRIISFTCF                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page