(data stored in ACNUC9435 zone)

EMBL: CP000904.PE64

CP000904.PE64        Location/Qualifiers
FT   CDS             101102..101596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CAC1508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5499"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46488"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV56"
FT                   /protein_id="ABY46488.1"
FT                   /translation="MKKFQSFDGTITMINDFVTGSNEDIGCNKLMSVDNGYGNLINFVV
FT                   KPNTYFIDYATVVVGDKVTGFYDANAPAPLIFPPQFQAIVMAKYTPHQNVKVDYFNEQL
FT                   ESSDGKLKLNISPSTQILLTNGQFFTGNLVNRNLIAIYSFTTMSIPAQTTPYKIIVLCQ
FT                   K"
     MKKFQSFDGT ITMINDFVTG SNEDIGCNKL MSVDNGYGNL INFVVKPNTY FIDYATVVVG        60
     DKVTGFYDAN APAPLIFPPQ FQAIVMAKYT PHQNVKVDYF NEQLESSDGK LKLNISPSTQ       120
     ILLTNGQFFT GNLVNRNLIA IYSFTTMSIP AQTTPYKIIV LCQK                        164
//

If you have problems or comments...

PBIL Back to PBIL home page