(data stored in ACNUC9435 zone)

EMBL: CP000904.PE65

CP000904.PE65        Location/Qualifiers
FT   CDS             102500..102934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2264 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5501"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46489"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV57"
FT                   /protein_id="ABY46489.1"
FT                   /translation="MRLIETVHIKWYGLYSLNDFYNREEAFKKGIFAISRVYAKNETLI
FT                   YIGKTKRSFIQKIRELNKDWIFDESELKITLGIIESPSGESYSEKKVKEIKSLLILRHT
FT                   PVENNTSLLYHRGQFNLKIINKGRRGLIVKKISTGDLMWT"
     MRLIETVHIK WYGLYSLNDF YNREEAFKKG IFAISRVYAK NETLIYIGKT KRSFIQKIRE        60
     LNKDWIFDES ELKITLGIIE SPSGESYSEK KVKEIKSLLI LRHTPVENNT SLLYHRGQFN       120
     LKIINKGRRG LIVKKISTGD LMWT                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page