(data stored in ACNUC9435 zone)

EMBL: CP000904.PE66

CP000904.PE66        Location/Qualifiers
FT   CDS             103173..103874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="BcerKBAB4_5502"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bce:BC3186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BcerKBAB4_5502"
FT                   /db_xref="EnsemblGenomes-Tr:ABY46490"
FT                   /db_xref="GOA:A9VV58"
FT                   /db_xref="InterPro:IPR009988"
FT                   /db_xref="UniProtKB/TrEMBL:A9VV58"
FT                   /protein_id="ABY46490.1"
FT                   /translation="MGQGSRFQEKQQNRRKKVIFNIAFTLVLVTVGIVTYQLFSPSDTS
FT                   KKAIAQEKKATKIEEKKHKEKEAAQLEEKKREVKEAAQLEEKEREEREAALLEEKKREE
FT                   REAALLEEKQKAEKSVKTSENENKEGEKTASQEKGSQTNPSWKPIGTEQGAKPAMQFKE
FT                   GTADWSEMKKAISYAVDVPESQLIFDFIGNNGNNKAYGNVRDKQSNKKYKVDIDWVENQ
FT                   GWKPASVQVVK"
     MGQGSRFQEK QQNRRKKVIF NIAFTLVLVT VGIVTYQLFS PSDTSKKAIA QEKKATKIEE        60
     KKHKEKEAAQ LEEKKREVKE AAQLEEKERE EREAALLEEK KREEREAALL EEKQKAEKSV       120
     KTSENENKEG EKTASQEKGS QTNPSWKPIG TEQGAKPAMQ FKEGTADWSE MKKAISYAVD       180
     VPESQLIFDF IGNNGNNKAY GNVRDKQSNK KYKVDIDWVE NQGWKPASVQ VVK              233
//

If you have problems or comments...

PBIL Back to PBIL home page